معلومة

هل توجد أي موارد على الإنترنت تحتوي على قائمة بالتعديلات اللاحقة للترجمة ووزنها الجزيئي؟

هل توجد أي موارد على الإنترنت تحتوي على قائمة بالتعديلات اللاحقة للترجمة ووزنها الجزيئي؟


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

أنا أدرس بروتينًا وأهتم بالتعرف على جميع التعديلات اللاحقة للترجمة التي أجراها (كما أقوم بتحليله عبر لطخة ويسترن). لقد وجدت قائمة بالتعديلات اللاحقة للترجمة التي أجراها ، ومع ذلك ، أريد أن أعرف ما هي الأوزان الجزيئية لتعديلات ما بعد الترجمة (في daltons / kilodaltons). لقد وجدت هذا الموقع ولكني لست متأكدًا من الفرق بين "تغيير الكتلة أحادي النظير" و "متوسط ​​التغيير الشامل" والوحدات التي توجد بها القيم.

كنت أتساءل عما إذا كانت هناك أي موارد موثوقة على الإنترنت تحتوي على قائمة بجميع التعديلات اللاحقة للترجمة الموجودة والأوزان الجزيئية المرتبطة بها؟ هي موضع تقدير أي رؤى.


لقد وجدت واحدة. نظرًا لأن الفروق بين عمودي "Monoisotopic" و "Average" في رابط Sigma-Aldrich الذي وجدته منخفضة للغاية ، يمكننا القول عمليًا أنها متساوية تقريبًا. الكتل بوحدات الكتلة الذرية ، أو دالتون.

ومع ذلك ، فإن هذه الأرقام هي من تغييرات الكتلة الفعلية التي شوهدت في الببتيدات المعدلة التي تم تحليلها بواسطة LC / MS / MS ، عادةً من البروتينات المهضومة. مواصفات الكتلة هي منصة دقيقة للغاية ، كما يمكنك أن ترى من خلال عدد المنازل العشرية في الأرقام الموجودة في الجدول. عند تقدير حجم البروتين بواسطة لطخة غربية ، يكون هامش الخطأ على الأقل 1 كيلو دالتون للبروتينات الأصغر (10-50 كيلو دالتون) و 5-10 كيلو دالتون أو أكثر للبروتينات الأكبر. نظرًا لأن حدث الفسفرة الفردي لن يؤدي إلا إلى تغيير كتلة البروتين المستهدف بمقدار 0.08 كيلو دالتون ، فإن تحديد ذلك من خلال لطخة غربية أمر مستحيل أساسًا. ومع ذلك ، تشير الأدلة إلى أن البروتينات المعدلة بواسطة حدث فسفرة واحد عادةً ما يكون لها أيضًا (أحيانًا العديد) تعديلات أخرى بعد الترجمة (PTMs) أيضًا ، بما في ذلك مواقع الفوسفو الأخرى ، والمثيلة ، والأستلة ، والجليكوزيل ، وما إلى ذلك ، والتي يمكن أن تؤثر بشكل واضح على تعديل. تنقل البروتين في هلام SDS-PAGE.

هناك عامل آخر يجب التفكير فيه وهو أنه في تغيير طبيعة المواد الهلامية SDS-PAGE (التي تتولد منها معظم اللطخات الغربية) ، لا تتأثر معدلات الترحيل فقط بالكتلة الجزيئية الكلية ، ولكن أيضًا بالشحنة ، حيث تنتقل البروتينات في مجال كهربائي. عندما يتم تحويل هذه البروتينات إلى خطي بواسطة SDS ، وهو منظف مشحون ، فإن شحنتها الإجمالية تتناسب تقريبًا مع حجمها. ومع ذلك ، فإن أجهزة PTM المشحونة مثل الفسفرة ستؤثر على هذه الرسوم الإجمالية ، وقد تعدل معدل الترحيل وفقًا لتلك الرسوم بالإضافة الى لكتلتهم الزائدة.

اجمع كل هذا معًا ، وستحصل على بروتينات معدلة PTM تهاجر بمعدلات مختلفة إلى حد ما عما قد يتوقعه المرء بناءً على الكتلة المادية للتعديل (التعديلات) وحدها. عندما تبدأ في الجمع بين العديد من أجهزة PTM ، خاصة الأنواع المختلفة من PTM (الفسفرة والأستلة ، على سبيل المثال) ، فقد يصبح من الصعب جدًا أو من المستحيل التنبؤ بالكتل الجزيئية الظاهرية المتوقعة.


الملخص

تعد تعديلات البروتين بعد الترجمة (PTMs) ميزة بكتيرية رئيسية تمتلك القدرة على تعديل وظيفة البروتين والاستجابات للإشارات البيئية. حتى وقت قريب ، تم إهمال دورهم في تنظيم أنظمة بدائية النواة إلى حد كبير. ومع ذلك ، فقد سمحت أحدث التطورات في البروتينات القائمة على قياس الطيف الكتلي بتحديد وتقدير لا مثيل لهما للبروتينات والببتيدات التي تخضع لـ PTMs في البكتيريا ، بما في ذلك الأنواع التي تؤثر بشكل مباشر أو غير مباشر على صحة الإنسان. هنا ، نعالج هذه المشكلة من خلال إجراء أكبر وأشمل تجميع ومقارنة عالمي لببتيدات PTM والبروتينات من الأنواع البكتيرية التي تم إجراؤها حتى الآن. تم جمع البيانات من 91 دراسة تتعلق بالببتيدات البكتيرية أو البروتينات التي تم تحديدها بواسطة طرق قياس الطيف الكتلي. كشف التحليل الحالي عن وجود تداخل كبير بين PTMs عبر الأنواع ، خاصة بين acetylation و PTMs الأخرى ، لا سيما succinylation. قد تقدم الأنواع الأقرب من الناحية التطورية مزيدًا من البروتينات الفوسفورية المتداخلة ، لكن المحفزات البيئية تساهم أيضًا في هذا القرب. تم العثور على PTM بين البكتيريا لتكون متعددة الاستخدامات ومتنوعة للغاية ، مما يعني أن نفس البروتين قد يخضع لمجموعة متنوعة من التعديلات المختلفة عبر عدة أنواع ، ولكنه قد يعاني أيضًا من تعديلات مختلفة داخل نفس النوع.


هل توجد أي موارد على الإنترنت تحتوي على قائمة بالتعديلات اللاحقة للترجمة ووزنها الجزيئي؟ - مادة الاحياء

تعديلات البروتين بعد الترجمة بعد إصابة الحبل الشوكي

Shuang Zhu 1، Bing-Sheng Yang 1، Si-Jing Li 1، Ge Tong 2، Jian-Ye Tan 1، Guo-Feng Wu 1، Lin Li 1، Guo-Li Chen ماجستير، دكتوراه 3 ، تشيان تشن دكتوراه 4 ، لي جون لين ماجستير، دكتوراه 1
1 قسم جراحة المفاصل والعظام ، مستشفى Zhujiang ، الجامعة الطبية الجنوبية ، قوانغتشو ، مقاطعة قوانغدونغ ، الصين
2 قسم الموجات فوق الصوتية الطبية ، مختبر مقاطعة قوانغدونغ الرئيسي لأبحاث أمراض الكبد ، المستشفى الثالث التابع لجامعة صن يات صن ، قوانغتشو ، مقاطعة قوانغدونغ ، الصين
3 قسم جراحة العظام ، المستشفى التابع لجامعة بوتيان ، بوتيان ، مقاطعة فوجيان ، الصين
4 مختبر البيولوجيا الخلوية والجزيئية ، قسم جراحة العظام ، كلية ألبرت الطبية بجامعة براون / مستشفى رود آيلاند ، بروفيدنس ، رود آيلاند ، الولايات المتحدة الأمريكية

تاريخ التقديم05-أغسطس -2020
تاريخ القرار11 سبتمبر 2020
تاريخ القبول22 نوفمبر 2020
تاريخ النشر على شبكة الإنترنت19 فبراير 2021

عنوان المراسلة:
Guo-Li Chen
قسم جراحة العظام ، المستشفى التابع لجامعة بوتيان ، بوتيان ، مقاطعة فوجيان
الصين
لي جون لين
قسم جراحة المفاصل والعظام ، مستشفى Zhujiang ، الجامعة الطبية الجنوبية ، قوانغتشو ، مقاطعة قوانغدونغ
الصين
تشيان تشن
مختبر الخلية والبيولوجيا الجزيئية ، قسم جراحة العظام ، كلية ألبرت الطبية بجامعة براون / مستشفى رود آيلاند ، بروفيدنس ، رود آيلاند
الولايات المتحدة الأمريكية

مصدر الدعم: تم دعم هذا العمل من قبل مؤسسة العلوم الطبيعية الوطنية في الصين ، رقم 81801210 (إلى SZ) ، تضارب المصالح: لا أحد

DOI: 10.4103/1673-5374.308068

إن أوجه القصور في القدرات العصبية الجوهرية في الحبل الشوكي ، ونقص دعم النمو ، وقمع نمو المحوار بواسطة الجزيئات المثبطة يعني أن إصابة الحبل الشوكي لها دائمًا عواقب وخيمة. على هذا النحو ، فإن أحد الأهداف الأساسية لعلاج إصابة الحبل الشوكي هو تطوير استراتيجيات لمقاومة العوامل الخارجية أو الداخلية المثبطة للنمو المحوري أو تعزيز العوامل التي تدعم نمو المحور العصبي. من بين هذه العوامل ، تم تحديد سلسلة من الاضطرابات الفردية على مستوى البروتين خلال توليد المحاور بعد إصابة الحبل الشوكي. علاوة على ذلك ، أشار عدد متزايد من الدراسات إلى أن التعديلات اللاحقة للترجمة لهذه البروتينات لها آثار مهمة على نمو المحور العصبي. اكتشف بعض الباحثين مجموعة متنوعة من التعديلات اللاحقة للترجمة بعد إصابة الحبل الشوكي ، مثل التيروزين ، والأستلة ، والفسفرة. في هذه المراجعة ، قمنا بمراجعة التعديلات اللاحقة للترجمة للنمو المحوري ، والتعافي الوظيفي ، وآلام الأعصاب بعد إصابة الحبل الشوكي ، وقد يؤدي فهم أفضل لها إلى توضيح التغيير الديناميكي للجزيئات المرتبطة بإصابة الحبل الشوكي وتسهيل تطوير مادة جديدة. الإستراتيجية العلاجية لإصابة الحبل الشوكي.

الكلمات الدالة: ضعف وظيفة المصفوفة خارج الخلية.


كيف تستشهد بهذا المقال:
Zhu S و Yang BS و Li SJ و Tong G و Tan JY و Wu GF و Li L و Chen GL و Chen Q و Lin LJ. تعديلات البروتين بعد الترجمة بعد إصابة الحبل الشوكي. تجديد الخلايا العصبية 202116: 1935-43

كيفية الاستشهاد بعنوان URL هذا:
Zhu S و Yang BS و Li SJ و Tong G و Tan JY و Wu GF و Li L و Chen GL و Chen Q و Lin LJ. تعديلات البروتين بعد الترجمة بعد إصابة الحبل الشوكي. ريجين ريجين [مسلسل على الإنترنت] 2021 [تم الاستشهاد به في 2021 يونيو 20] 16: 1935-43. متاح من: http://www.nrronline.org/text.asp؟2021/16/10/1935/308068

شوانغ تشو ، بينغ شنغ يانغ. ساهم هؤلاء المؤلفين بالتساوي على هذا العمل.

بشكل عام ، يمكن تقسيم اصابات النخاع الشوكي إلى ثلاث مراحل (Tator et al. ، 2009). تبدأ المرحلة الحادة ، الناتجة عن التلف الميكانيكي لأنسجة الحبل الشوكي من الصدمات المباشرة أو موجات الصدمة ، في حركة عدد من العمليات الفيزيولوجية المرضية المتوازية. يمكن أن يؤدي الاضطراب الميكانيكي للأنسجة العصبية والأوعية الدموية إلى نخر وموت الخلايا ، ويمكن أن يؤدي عدم التوازن الأيوني لـ K & # 43 و Na & # 43 و Ca 2 & # 43 إلى ضعف الوظيفة العصبية وصدمة العمود الفقري (Baumann ، 2020). علاوة على ذلك ، تخضع المحاور المقطوعة لتنكس والريان لمزيد من التفاصيل للجزء البعيد من المحور العصبي ، بالإضافة إلى أغلفة المايلين المرتبطة بها. يمكن أن تحدث المرحلة الثانوية (مرحلة الإصابة تحت الحادة) من اصابات النخاع الشوكي أي شيء من بضع دقائق إلى بضعة أسابيع بعد الإصابة ، حيث يتضرر الجهاز العصبي بشدة (لين ، 2020). تتضمن الفيزيولوجيا المرضية لهذه المرحلة عمليات متعددة ، مثل موت الخلايا المبرمج وتكوين الجذور الحرة. زيادة تركيز السيتوكين والتسلل المستمر للخلايا الليمفاوية التي تحدث بعد موت الخلايا يؤدي بدوره إلى زيادة موت الخلايا بسرعة. قد تتطور اصابات النخاع الشوكي إلى مرحلة مزمنة أي شيء من أيام قليلة أو بضع سنوات بعد الإصابة ، وخلالها ستذوب المادة الرمادية في الجسم تدريجيًا ، وسيترسب النسيج الضام تدريجيًا ، وستتشكل الندوب الدبقية (Liu et al.، 2019) . علاوة على ذلك ، يؤدي فرط الاستثارة الدائم في العديد من الخلايا إلى ألم مزمن في الأعصاب لدى معظم المرضى (Bahari et al.، 2019 Calvo et al.، 2019).

خلال كل مرحلة من هذه المراحل ، تتم العديد من العمليات على مستويات النسخ ، وتحرير الحمض النووي الريبي ، والترجمة ، والتعديل اللاحق للترجمة (PTM) (Mierke ، 2020). من بين هؤلاء ، أثارت PTM على وجه الخصوص الاهتمام في العقود الأخيرة لأنه يمكن التلاعب بها بشكل عكسي مقارنة بعملية النسخ التي لا رجعة فيها وتحرير RNA والترجمة. التعديل اللاحق للترجمة هو عملية التعديل الكيميائي لسلاسل البولي ببتيد بعد النسخ والترجمة. في الخلايا ، يلعب PTM الدور التنظيمي الرئيسي في التغيير التوافقي للبروتينات. بمشاركة PTM ، يغير الجسم وبروتينات # 8217 شكلها ، مما يؤثر بدوره على تفاعلاتها ذات الصلة مع البروتينات المختلفة ويؤثر على تحويل الإشارات النهائية (Czuba et al. ، 2018). علاوة على ذلك ، فإن العديد من التغييرات الوظيفية للبروتينات التي أدخلتها PTMs فورية وقابلة للعكس. سيكون التحكم المماثل في التغيير الوظيفي عن طريق تخليق de novo أو تدهور البروتين أكثر استهلاكا للوقت واستهلاكًا للطاقة الحيوية أكثر من PTMs (Uversky ، 2013). بهذا المعنى ، فإن استهداف PTMs أكثر دقة واقتصادية من استهداف النسخ الجيني والترجمة. بالمقارنة مع العملية المرضية المتغيرة بسرعة لاصابات النخاع الشوكي ، يتغير التعبير الجيني بعد اصابات النخاع الشوكي بطيئة. بينما يمكن لـ PTMs على البروتينات أو الأحماض الأمينية تغيير وظيفة البروتينات على الفور & # 8217 ، مما يجعل PTM الهدف المثالي لإبطاء أو إيقاف مراحل التحول بشكل كبير من اصابات النخاع الشوكي. تم الإبلاغ عن أن PTM متورط في العديد من العمليات الفيزيولوجية المرضية للاصابات النخاع الشوكي ، مثل تجديد محور عصبي (Voulalas et al. ، 2017 Qi et al. ، 2019) ، وتشكيل الندبة الدبقية (Gliem et al. ، 2015 Wang et al. ، 2016) ) ، إنتاج الجزيء المثبط (Wong et al. ، 2018) ، اللدونة غير القادرة على التكيف (Imagama et al. ، 2011) ، وظهور ألم الأعصاب (Lai et al. ، 2016). يمكن تحليل PTM وتصنيفه إلى أنواع معدلة أولاً ، تعديلات الأحماض الأمينية ، مثل التحلل البروتيني ، والتي يمكن أيضًا تخفيفها لتمكين انقسام البروتين ثانيًا ، وتعديل الجزيئات المعقدة من خلال عمليات مثل الارتباط بالجليكوزيل والأسيل ، مما يسمح بالتركيب الجزيئي للبروتينات ليتم توسيعها ثالثًا ، التعديلات الكيميائية ، مثل الأكسدة والميثلة والرابعة ، تعديل متعدد الببتيد ، مثل التواجد في كل مكان و sulfonylation (Audagnotto et al. ، 2017 Spoel ، 2018). يؤثر PTM على العمليات الفسيولوجية للخلايا عندما يمارس الجسم أنشطة فسيولوجية طبيعية وأنشطة فسيولوجية غير طبيعية ، ويمكنه تعديل وظيفة البروتينات عن طريق تحطيم البروتينات ، والتأثير على التفاعل بين البروتينات ، وتغيير بنية البروتينات (بيلتراو وآخرون ، 2013 L & # 252scher et al.، 2018 Gao et al.، 2020). تم توثيق العديد من PTMs في سياق اصابات النخاع الشوكي ، بما في ذلك acetylation (Hubbert et al. ، 2002 Reed et al. ، 2006) ، nitrosylation (Scheving et al. ، 2012 Khan et al. ، 2019) ، الفسفرة (Xu et al. ،. ، 2006 Voulalas et al.، 2017)، ribosylates (Kuzhandaivel et al.، 2010)، ubiquitination (Lai et al.، 2016 Jeong et al.، 2018)، and oxidation (Ingles et al.، 2016). ومع ذلك ، لا يزال من غير الواضح كيف يساهم كل من هذه التعديلات في عملية الفيزيولوجيا المرضية لاصابات النخاع الشوكي ، أو مقدار الدور الذي يلعبه تعديل الدور في كل عملية فيزيولوجية مرضية أو ضعف وظيفي محدد. يتم إعاقة تجديد الحبل الشوكي بشكل أساسي بسبب تقلص القدرات العصبية الجوهرية والبيئة المثبطة الخارجية. هنا ، قمنا بمراجعة PTMs المبلغ عنها حول العوامل الداخلية والخارجية التي تؤثر على انتعاش اصابات النخاع الشوكي. النتائج التي توصلنا إليها تشير إلى أن PTM هو هدف علاجي مهم لاصابات النخاع الشوكي ، لأنه أكثر تنظيمًا وعكسًا من الاستراتيجيات العلاجية التقليدية. علاوة على ذلك ، فإن دوره في السيطرة على آلام الأعصاب يبشر بالعمل السريري في المستقبل ويجب دراسته في العمل المستقبلي.

أجرينا بحثًا في PubMed للمرضى الذين لديهم نماذج حيوانية من اصابات النخاع الشوكي / الخلايا العصبية ، وتكوين الخلايا العصبية / التنكس العصبي / تجديد محور عصبي ، ونتائجهم. تم تحديد الدراسات المنشورة من 1992 إلى 2020 على PTM بعد اصابات النخاع الشوكي في قاعدة بيانات PubMed. مزيد من المعلومات التفصيلية حول PTMs المحددة بعد البحث في اصابات النخاع الشوكي باستخدام المصطلح & # 8220SCI & # 8221 بالاشتراك مع المصطلح المطلوب (على سبيل المثال ، & # 8220phosphorylation & # 8221). لاستكشاف acetylation بمزيد من العمق ، تم أيضًا دمج المصطلح & # 8220acetylation & # 8221 مع المصطلح & # 8220SCI & # 8221. تم الحصول على منشورات عن تكوين الخلايا العصبية والتنكس العصبي وتجديد محور عصبي من خلال الجمع بين هذين المصطلحين مع المصطلح & # 8220SCI & # 8221. تم التحقق من ملاءمة المنشورات المحددة من خلال التحقق من وجود مصطلحات البحث في العنوان والملخص والكلمات الرئيسية. تم استبعاد التجارب غير اصابات النخاع الشوكي. ركزنا على النتائج العامة بدلاً من النتائج الحديثة حيثما أمكن ذلك.

التعديلات اللاحقة للترجمة الأنابيب الدقيقة

أتاشي وآخرون (1992) أن مدى فسفرة التوبولين استجابة لإشارات الالتصاق الموضعية التي يواجهها مخروط النمو يمكن أن يؤثر على بلمرة الأنابيب الدقيقة لتنظيم تجديد الأعصاب. وجد المؤلفون أن جزيئات التصاق الخلايا والأجسام المضادة لجزيئات التصاق الخلية تمنع فسفرة التوبولين في الأغشية المخروطية للنمو. البروتين المرتبط بالأنابيب الدقيقة 1B (MAP1B) ، والذي يتم التعبير عنه في الخلايا العصبية والدبقية ، هو بروتين رئيسي مرتبط بالنمو والهيكل الخلوي. أفادت الدراسات ذات الصلة أنه عندما يعمل MAP1B ، يمكن أن يتأثر بالفسفرة MAP1B. في عملية دراسة PC12 (خط خلوي مشتق من ورم القواتم في النخاع الكظري للجرذ) نمو محوار الخلية ، اكتشف الباحثون بنجاح هذه الظاهرة أن فسفرة MAP1B تساهم في التغييرات الوظيفية لـ MAP1B عند استخدام تحريض NGF (Migita et al. ، 2019). يمكن العثور على كمية كبيرة من MAP1B في المحاور النامية ، وبعد الفسفرة ، يعزز MAP1B نمو مخاريط النمو (Ramkumar et al. ، 2018 Igarashi ، 2019)

ومع ذلك ، فإن فسفرة MAP1B لا تعزز بالضرورة نمو العصبونات (Igarashi et al. ، 2020). أفاد بعض الباحثين أنه بعد إصابة الفئران بحمض الألجنيك ، يمكن حرمان الألياف الواردة من معالجة حمض الألجنيك ، مما يعزز بشكل فعال التعبير عن MAP1B ويزيد من فسفرته (Soares et al. ، 1998). علاوة على ذلك ، بعد الارتجاج ، تم العثور على الفئران لإعادة التعبير عن MAP1B وأنه أيضا فسفرته. لذلك ، يبدو أن وجود هذه البروتينات يسمح للخلايا العصبية بالتجدد (Emery et al. ، 2000).

تم العثور على أسيتيل توبولين يلعب دورًا في العديد من الوظائف الفسيولوجية ، فهو لا يعزز نمو المحاور العصبية فحسب ، بل يلعب أيضًا دورًا في تفرع محور عصبي (Rossaert et al. ، 2020). يؤثر Tubulin deacetylase و Histone deacetylase 6 (HDAC6) و sirtuin 2 (SIRT2) على حالة أستلة التوبولين. أظهرت بعض الدراسات أن أستلة & # 945-tubulin في Lys40 يسهل النقل المحوري من خلال تعزيز ارتباط البروتينات الحركية kinesin و dynein بالأنابيب الدقيقة (Mo et al. ، 2018 Rossaert et al. ، 2020). كما وجد أن HDAC6 يزيل الأسيتيل توبولين (هوبرت وآخرون ، 2002). علاوة على ذلك ، يمكن زيادة أستلة & # 945-tubulin عن طريق تثبيط HDAC6 ، الذي يعزز النقل المحوري وقد وجد أنه مفيد في النماذج الحيوانية للأمراض التنكسية العصبية ، مثل مرض هنتنغتون # 8217s (Guo et al. ، 2017). باستخدام نموذج الماوس من اصابات النخاع الشوكي ، دان وآخرون. أظهر (2018) أنه من خلال استئصال MEC-17 ، يمكن تثبيط أستلة التوبولين # 945 ، مما يؤدي بدوره إلى فرط نمو المحاور العصبية. يؤدي هذا بعد ذلك إلى تفكيك الأنابيب الدقيقة ، والتي تغزو بعد ذلك أرجل الخيط. في دراسة أخرى لنموذج فأر SCI ، Zheng et al. وجد (2020) أن مستوى HDAC6 في الجسم زاد بشكل كبير بعد اصابات النخاع الشوكي ، بينما تسبب تثبيط HDAC6 بواسطة Tubastatin A في استعادة وظيفية في نموذج فأر SCI الرض. كان هذا على الأرجح لأن تثبيط HDAC6 يمكن أن يؤدي إلى أستلة وتثبيت الأنابيب الدقيقة وبالتالي استعادة وظيفة النقل ، مما قد يؤدي إلى زيادة طول محور عصبي واستعادة التدفق الذاتي. وفقًا للتقارير ذات الصلة ، يمكن لـ Elp3 تعزيز الأستلة وتثبيط تنظيم HDAC6 ، ويمكن أن يؤدي إسكات خلايا Elp3 إلى تأخير الهجرة وإتلاف الفروع العصبية (Creppe et al. ، 2009).

أظهرت الأبحاث السابقة بوضوح أن نمو المحاور يتأثر بعد حدوث اصابات النخاع الشوكي ، وأن هناك علاقة وثيقة بين هذه العملية والنقل الرجعي المعتمد على الأنابيب الدقيقة (Mo et al.، 2018 Guo et al.، 2020 Rossaert et al.، 2020). عند تحليل بنية الأنابيب الدقيقة ، وجد المؤلفون أن & # 946-tubulin و C-terminus من & # 945-terminus قد تعرضوا. هذا الموقع هو أيضا جوهر MAPs. قد يساعد أيضًا إزالة التعرق والغلوتاميل والجليكوزيل للأنابيب الدقيقة في تنظيم تفاعل ونشاط MAPs والمحركات الجزيئية (Janke et al. ، 2011).عند إصابة المحاور ، يعمل توبولين تيروزين ليجاس (TTL) في الموقع التالف على زيادة مستوى & # 945-tubulin tyrosine ، والذي يمكن أن يعزز النقل الرجعي لإشارات الإصابة (Song et al. ، 2015). أظهر بعض الباحثين أنه في الحيوانات البرية ، يمكن تثبيط إزالة الأنبوب الدقيق باستخدام سيسكيتيربين لاكتون زاحف لاكتون. إذا تم علاج الجسم كله أو جزء من الجسم بهيدروكينون لاكتون ، فيمكن تعزيز تجديد المحاور والتعافي الوظيفي. لذلك ، يمكن الافتراض أن تثبيط إزالة تآكل الأنابيب الدقيقة قد يحسن من تأثير العلاج عند علاج المرضى الذين يعانون من إصابة الأعصاب (Gobrecht et al. ، 2019).

أظهرت الدراسات أنه إذا كان من الممكن الاحتفاظ بالمحاور في حالة مستقرة ، فإن مستوى ارتباط الأنابيب الدقيقة متعدد الجلوتاميل يكون مرتفعًا ، في حين أن الجسم لديه نشاط منخفض من الجلوتاميناز (Audebert et al. ، 1993). إيكيغامي وآخرون وجد (2006) أن بروتين تيوبولين التيروزين الشبيه بالليغاز (TTLL) يعزز تعدد الجلوتاميل ، والذي يمكن نسخه على أعلى مستوى في الجهاز العصبي. بالإضافة إلى ذلك ، يرتبط ارتباط الغلوتاميل المفرط في الأنابيب الدقيقة ارتباطًا مباشرًا بالتنكس العصبي ، كما أن التنظيم الخافت للإنزيم الرئيسي متعدد الجلوتامات أميلاز TTLL1 في الدماغ يمنع جزئيًا تنكس خلايا بركنجي في مخيخ فئران PCD (Rogowski et al. ، 2010). أشارت بعض الأبحاث إلى أنه ، كنوع من & # 946-tubulin polyglutaminase ، هناك علاقة وثيقة بين TTLL7 و MAP2-positive neurites في خلايا تشبه الزوال (PC12) (Ikegami et al. ، 2006 Sferra et al. ، 2020 ). ما هو أكثر من ذلك ، ماس وآخرون. وجد (2009) أن تعدد الجلوتاميل يؤثر على نشاط الخلايا العصبية في الفئران من خلال تنظيم نقل الحويصلة المشبكية.

مسار التحفيز تعديلات ما بعد الترجمة

يتم تنشيط كيناز تنظيم الإشارات خارج الخلية (ERK) استجابة لعوامل التغذية العصبية المختلفة (Hausott et al. ، 2019 Jin et al. ، 2020). يعمل ERK على تعزيز حركة مخروط النمو والتجديد بعد إصابة محور عصبي في محاور عصبية الجذر الظهرية البالغة (Manire ، 2019 Liu et al. ، 2020). باستخدام نموذج الفئران لاصابات النخاع الشوكي ، الناجم عن قطع الحبل الشوكي ، Xu et al. (2006) أظهر أن النترات يمكن أن تعدل 3-نيتروتيروسين بعد اصابات النخاع الشوكي. عندما يكون اصابات النخاع الشوكي في المرحلة الحادة ، فإن زيادة هجوم أكسيد النيتريك لا يؤدي فقط إلى زيادة مستوى الفسفرة في ERK1 / 2 ، بل يزيد أيضًا من مستوى البروتين كيناز الذي يتم تنشيطه بواسطة p38 ميتوجين. وتلعب هذه البروتينات دورًا مهمًا في التنكس العصبي بعد اصابات النخاع الشوكي الحادة. علاوة على ذلك ، تم العثور على تنشيط K & # 43 / Cl & # 8211 cotransporter 2 (KCC2) ليكون مفيدًا في السيطرة على آلام الأعصاب والتعافي من إصابة الحبل الشوكي (Cardarelli et al. ، 2017 Chen et al. ، 2018). يتم تنظيم إعادة تدوير الغشاء التأسيسي لـ KCC2 من خلال حالة الفسفرة لبقايا سيرين C-terminal 940 (S940). يحد الفسفرة لـ S940 في KCC2 بواسطة بروتين كيناز C (PKC) من انقسام KCC2 في الليزوزومات بعد الالتقام المعتمد على الكلاذرين ، ويقلل من معدل استيعاب KCC2 من غشاء البلازما (Lee et al. ، 2007). ويتم تنظيم تعبير KCC2 بعد تنشيط كل من شلالات إشارات PLC & # 9471 و Shc لمسار BDNF-TrkB ، وهو أمر واضح في موقع ما حول الآفة حيث يتراكم BDNF بعد اصابات النخاع الشوكي (كارتر وآخرون ، 2018). علاوة على ذلك ، ينشط BDNF الخلايا العصبية m-Calpain ، وهو بروتياز ينتج عنه تعطيل لا رجعة فيه لـ KCC2 عبر الفسفرة بوساطة MAPK (Puskarjov et al. ، 2012). بالإضافة إلى ذلك ، يزيد تنشيط مستقبلات NMDA من تركيزات Ca 2 & # 43 داخل الخلايا ، ويتم استيعاب KCC2 في العصارة الخلوية من أجل نزع الفسفرة S940 بواسطة بروتين فوسفاتيز 1 (PP1) ، وبالتالي تقليل مستويات KCC2 الوظيفية في غشاء البلازما (Lee et al. ، 2011) .

مسار المثبط تعديلات ما بعد الترجمة

اقترح بعض الباحثين أنه بعد اصابات النخاع الشوكي ، يزداد مستوى التعبير لمسار إشارات Rho (Hong et al. ، 2019 Xiao et al. ، 2019). يؤدي تنشيط Rho ومؤثره ROCK kinase إلى انهيار مخروط النمو ويمثل عقبة مهمة أمام تجديد محور عصبي (Koch et al. ، 2018). تم الإبلاغ عن أنه نظرًا للتأثيرات المثبطة لـ Rho و ROCK ، لا يمكن لبروتيوجليكان كبريتات شوندروتن (CSPG) أن يمنع نمو العصبونات (Monnier et al. ، 2003). وكبريتات شوندروتن & # 8194 يحد من انتقال الخلايا الجذعية العصبية من خلال تنشيط & # 8194ROCK & # 8194 (Galindo et al. ، 2018). علاوة على ذلك ، ورد أن توجيه وتمديد المحاور العصبية يتأثران بعائلة Rho للنيوكليوتيدات ثلاثي الفوسفاتيز (GTPases) (Galino et al. ، 2019). يمكن أن تؤثر ترجمة وتعديل Rho GTPases على نشاط Rho GTPases (Denk-Lobnig et al. ، 2019). يمكن أن يحدث الانزلاق الأولي عند الطرف C للبروتينات ، ويساعد وجود عملية التحلل الأولي على توجيه نمو النوريت (جينينغز وآخرون ، 2018 ريدي وآخرون ، 2020). علاوة على ذلك ، يقوم بروتين وسيط استجابة Collapsin 2 (CRMP2) بتنسيق تكوين الهيكل الخلوي وتنظيم الانقسام الخلوي والهجرة والقطبية والاتصال المشبكي. تثبيط الفسفرة CRMP2 يعزز تجديد محور عصبي و / أو تنبت المحاور الحركية والحسية ، ويثبت الأنابيب الدقيقة في الخلايا النجمية لمنع تكوين الندبة الليفية بعد اصابات النخاع الشوكي ، ويقلل من تسلل الخلايا الالتهابية (Nagai et al. ، 2016).

خلال المرحلة المزمنة من اصابات النخاع الشوكي ، هناك العديد من التغيرات الفسيولوجية في الجسم ، مثل تكاثر الخلايا الدبقية ، وترسب النسيج الضام ، وانحلال المادة الرمادية التي تسبب تكون ندبات دبقية على النخاع الشوكي (برادبري). وآخرون ، 2019). جزيئات المصفوفة خارج الخلية والخلايا النجمية التفاعلية هي المواد الرئيسية التي تشكل الندوب الدبقية (He et al. ، 2020). بعد اصابات النخاع الشوكي ، يرتبط عدد كبير من الخلايا النجمية بمنطقة الندبة ، حيث يؤدي وجود هذه الخلايا النجمية إلى زيادة القوة الميكانيكية للأنسجة ، مما يجعل هجرة الخلايا ونمو المحور العصبي عبر الأنسجة أكثر صعوبة. علاوة على ذلك ، تتراكم الجزيئات المثبطة لنمو المحوار التي ترتبط بالغشاء القاعدي اللزج للندبة في موقع الآفة بتركيزات محلية عالية (تران وآخرون ، 2018).

في إحدى الدراسات ، قام Besson et al. (2004) أن مثبط كيناز p27kip1 المعتمد على السيكلين يؤثر على الأنشطة الفسيولوجية للخلايا النجمية ، ويلعب دورًا في هجرة الخلايا وتكاثرها. أظهرت دراسة سابقة أن تثبيط O-GlcNAcylation لـ p27Kip1 على Ser2 عن طريق طفرة جينية (S2A) يخفف من فسفرة Ser10 في الخلايا النجمية ، مما يعزز حركية الخلايا النجمية ويقلل من تكوين الندبات في الفئران التي تعاني من كدمة الحبل الشوكي (Mao et al. ، 2015). في نموذج الفئران لاصابات النخاع الشوكي ، Zhao et al. وجد (2011) أنه في المرحلة G1 من دورة الخلية ، يمكن أن يتحلل ubiquitin ligase KPC من p27kip1. كوحدة فرعية تحفيزية لـ KPC ، توجد علاقة وثيقة بين KPC1 وتكاثر الخلايا النجمية للفئران (Zhao et al. ، 2011).

الارتباط بالجليكوزيل هو عملية تعديل ترجمة لا تؤثر فقط على التوطين الخلوي ، بل تؤثر أيضًا على بنية البروتين. تم العثور على السلفونيل المطلوب للنسخ المعتمد على C / EBP & # 948 ليكون مثبطًا بعد إعطاء محفزات شحمية وعامل نمو البشرة (Lai et al. ، 2008). علاوة على ذلك ، تم إثبات أن C / EBP & # 948 يساهم في تكوين الندبة الدبقية ، مما يضعف الانتعاش الوظيفي بعد الفئران و # 8217 اصابات النخاع الشوكي (وانج وآخرون ، 2016).

بصرف النظر عن التندب ، تعتبر الجزيئات المثبطة من العناصر الرئيسية للبيئة المثبطة بعد اصابات النخاع الشوكي. في الواقع ، تعمل الندبة الدبقية كحاوية طبيعية للجزيئات المثبطة ، مما يزيد من تركيز الجزيئات المثبطة ويؤدي إلى تفاقم التأثير المثبط. الجزيئات المرتبطة بالمايلين هي أكثر مجموعات المثبطات التي تمت دراستها ، أحدها Nogo-A ، والذي يرتبط بالمستقبلات الموجودة في غشاء الخلايا العصبية ، ويمنع النمو ، وفي نفس الوقت يتسبب في انهيار مخاريط النمو (Zhao et al. ، 2019 ). يعزز استئصال Nogo-A فسفرة LIMK1 ، مما يزيد من تنشيط cofilin عن طريق تقليل الفسفرة. يقال أيضًا أن ديناميكيات الأكتين تنظمها Cofilin ، والتي يمكن أن تقطع نشاط الشعيرات ، وبالتالي تنظم قوة البروتينات الحركية (Montani et al. ، 2009). يشير هذا إلى وجود علاقة وثيقة بين العصبون Nogo-A وحركة مخروط النمو. من حيث تعديل Nogo-A نفسها ، Yokoyama et al. (2006) وجد أن Nogo-A تمت فسفرته بواسطة Src-family kinases في Tyr-694 ، مما يشير إلى أن وظائف Nogo-A لها مستوى إضافي من التعقيد.

يمكن تعزيز أستلة الأنابيب الدقيقة & # 945-tubulin عن طريق تثبيط هيستون ديسيتيلاز 6 (HDAC6) ، مع استعادة نمو المحاور المثبطة لـ CSPGs و MAG (Rivieccio et al. ، 2009) على العكس من ذلك ، tubulin acetyltransferase-1 ( & # 945TAT1 acetylation) له وظيفة معاكسة (كويفا وآخرون ، 2012). باحثون مثل Wong et al. (2018) استخدم نموذج الماوس الخاص بـ SCI لإظهار أن & # 945TAT1 خاضع للتنظيم من خلال تأثير MAG و CSPG ، بينما تظل مستويات HDAC6 أو نشاط HDAC6 دون تغيير مع التعرض لـ CSPGs و MAG. علاوة على ذلك ، فإن الإفراط في التعبير عن & # 945TAT1 الخاضع للتنظيم يمكن أن يعيد نمو النوريت ، مما قد يشير إلى أن استهداف & # 945TAT1 على مستوى ما بعد الترجمة يمكن أن يكون له إمكانات علاجية بعد اصابات النخاع الشوكي.

تنتمي CSPGs إلى فئة البروتيوجليكان (Listik et al. ، 2019) ، والتي لا تعمل فقط كمثبطات ، ولكن أيضًا كدليل لنمو المحاور ومكتشف بعد اصابات النخاع الشوكي (Schmidt ، 2019). وجدت الدراسات السابقة أن سلسلة CS وسلسلة KS وسلسلة N-glycans من CSPG تمنع نمو النوريت. ومع ذلك ، فإن مساهمة كل من هذه المكونات لم يتم فحصها بعد باستخدام استراتيجية تعديل ما بعد الترجمة ، قام مؤلفو دراسة واحدة بهضم المكونات الثلاثة بواسطة إنزيمات محددة ، على التوالي ، ووجد أن CS و N-glycans يثبطان نمو النوريت لـ NS. -1 خلايا (Hering et al. ، 2020). يشير هذا إلى أن PTMs لـ CSPG عند نمو نورت قد يكون هدفًا علاجيًا لـ SCI.

مصفوفة metalloproteinases

لا تشارك البروتينات المعدنية للمصفوفة (MMPs) فقط في التفاعل بين الخلايا ، ولكن أيضًا في التفاعل بين الخلايا والمصفوفة خارج الخلية. تتداخل MMPs مع عملية التحلل ، وهو أمر ضروري أثناء التطور الطبيعي والتئام الجروح وإعادة تشكيل مصفوفة الإصلاح مدى الحياة (Sanderson et al. ، 2019). في اصابات النخاع الشوكي ، ثبت أن MMPs تساهم في الاستجابة الالتهابية العصبية التقدمية ، الإجهاد التأكسدي ، موت الخلايا المبرمج ، وتدهور الندبة الدبقية (Zhang et al. ، 2011). حدوث المضاعفات بعد اصابات النخاع الشوكي يعتمد على عدة عوامل ، بما في ذلك متى وأين يتم التعبير عن MMPs وملف ركائزها المتاحة من MMPs. على سبيل المثال ، منع MMPs في المرحلة المبكرة من اصابات النخاع الشوكي يمكن أن يجعل الحاجز أكثر استقرارًا ، ويقلل من موت الخلايا المبرمج ، ويحمي الخلايا العصبية. ومع ذلك ، في المرحلة المزمنة من اصابات النخاع الشوكي ، يؤثر تكوين الندبات الدبقية على نمو البروتينات خارج الخلية (Mirzaie et al.، 2018).

يمكن أن تجعل ترجمة وتعديل MMPs ركائزها مرتبطة بشكل أفضل بالمصفوفة خارج الخلية. تم العثور على Glycosylation من MMPs لتحسين ارتباطها بشكل كبير مع المصفوفة خارج الخلية (Agarwal et al. ، 1999). باعتباره أكثر منتجات MMPs الغليكوزيلاتي شيوعًا ، لا يحتوي MMP9 فقط على مواقع الارتباط بالجليكوزيل المرتبطة بـ N Asn120 في المجال التحفيزي ، ولكن أيضًا مواقع الارتباط بالجليكوزيل المرتبطة بـ N في المجال المؤيد (Vandooren et al. ، 2013). تم الإبلاغ عن أن الارتباط بالجليكوزيل في Asn38 و galectin 8 يزيد من المعالجة بوساطة MMP3 ، كما أن الارتباط بالجليكوزيل في Asn38 و galectin 3 يقلل من تنشيط التحلل البروتيني لـ MMP9. لذلك ، يبدو أن نشاط MMP9 يتأثر بالنيكلوزيل (Boon et al. ، 2019). Duellman et al. (2015) أنه من خلال تثبيط الارتباط بالجليكوزيل لـ MMP9 في Asn120 ، يمكن تقوية تأثير التفاعل بين الكالريتيكولين و MMP9 ، ويمكن تقليل كفاءة إفرازه.

يمكن تنظيم MMP عن طريق الفسفرة ، ويمكن تحديد مواقع الفسفرة مثل Ser- و Thr- من خلال دراسة مجال MMP (Ardito et al. ، 2017). لقد وجد بعض الباحثين أن بروتين كيناز سي يلعب دورًا تنظيميًا في فسفرة MMP-2 (Sariahmetoglu et al. ، 2007). يو وآخرون. (2000) أكد أنه ، كعضو في عائلة GAG ، يمكن لكبريتات الهيباران التوسط في العلاقة بين سطح الخلية والفقاريات المفرزة MMPs ، وأن علاقة الوساطة هذه محددة ، نظرًا لأن مستخلصات الهيبارين الزائدة القابلة للذوبان وتذوب MMP-2 ، MMP -13 و MMP-7 و MMP-9. أظهرت الدراسات السابقة أن الهيبارين ، كبريتات الهيبارين عالية الكبريت ، بالإضافة إلى كبريتات الهيبارين ، يؤثر على التعبير ومستويات البلازما لـ MMP9 ، ويزيد أيضًا من تقارب TIMP3 مع MMP2 و MMP7 و MMP9 (Mannello et al. ، 2008) . لذلك ، يمكن اعتبار PTMs لتعديل مواقع متعددة من MMPs ، وبالتالي التأثير على نشاطهم بدرجات متفاوتة ، وقد تؤثر هذه العملية على التجديد بعد اصابات النخاع الشوكي.

تشوي وآخرون. (2007) أن هناك العديد من بروتينات الالتصاق في المصفوفة خارج الخلية ، أحدها osteopontin ، وهو سيتوكين قابل للذوبان يتكون من الخلايا الدبقية الصغيرة والخلايا النجمية. يمكن تعديل Osteopontin بعدة طرق ، مثل عن طريق الكبريت والجليكوزيل ، ويمكن أن يرتبط بمختلف مركبات الإنتجرينات من خلال مستقبل CD44 للسماح للكائنات الحية بأداء وظائف فسيولوجية مختلفة (Sodek et al. ، 2000). جليم وآخرون. وجد (2015) أن osteopontin متورط في مجموعة متنوعة من الوظائف الفسيولوجية في المختبر، والتي من خلالها يمكن أن يمنع تلف الجهاز العصبي والوذمة الدماغية. وبالمثل ، أفاد Plantman (2012) أن مصفوفة osteopontin يمكن أن تعزز نمو محور عصبي في المختبر.

الندبات الليفية ، التي تظهر بعد اصابات النخاع الشوكي ، تتكون من فبرونيكتين ولامينين ، مع زيادة الترسب في لب الآفة وانخفاض ترسب في منطقة الخلايا النجمية (Orr et al.، 2018). يعتبر الغشاء القاعدي أحد أهم هياكل الندبة ، بينما يتكون قلب الأغشية القاعديّة من شبكة كثيفة من الكولاجين الرابع التي تشكل بنية فوق الجزيئية كبيرة. تخلق هذه البنية الأساسية سقالة ثابتة يمكن أن ترتبط بها البروتينات والخلايا الملتصقة (Sanderson et al. ، 2019). بعد الترجمة ، تقوم الخلية بترجمة وتعديل الكولاجين الرابع المركب حديثًا من خلال عمليات مثل الارتباط بالجليكوزيل والهيدروكسيل (Hennet ، 2019). وفقًا لبحث سابق ، يتم إعاقة تخليق الكولاجين بواسطة الكولاجين الرابع ، وبالتالي يمنع الجسم من تكوين غشاء قاعدي. بهذه الطريقة ، يمكن تعزيز تجديد محاور الجهاز العصبي المصابة (Stichel et al. ، 1999).

يتم إنتاج اثنين من البروتينات قليلة القسيمات متعددة المجالات المضادة للالتصاق - tenascin-C و tenascin-R- في الجهاز العصبي المركزي. تشارك هذه البروتينات في مجموعة متنوعة من الأنشطة الفسيولوجية ، مثل التفاعل بين عوامل النمو والخلايا ، والتصاق الخلايا ، وهجرة الخلايا العصبية (Giblin et al. ، 2015). يمكن أن يخضع Tenascin-C لعملية الارتباط بالجليكوزيل عبر مواقع الارتباط بالجليكوزيل المتعددة ، والتي وُجد أنها تزيد من قدرة تكاثر الخلايا الجذعية العصبية للفأر (Yagi et al. ، 2010). بالإضافة إلى ذلك ، يمكن أن يكون لدى Tenascin-C أيضًا قدرة ربط أقوى من خلال التعديل. جيبلين وآخرون. (2015) اقترح أن هذا يرجع إلى الانقسام التحلل للبروتين. ينظم تطور الجسم عملية الارتباط بالجليكوزيل لـ TN-R ويؤثر على حركتها وهجرتها (Woodworth et al. ، 2004). تم الإبلاغ عن أنه يمكن توصيل TN-R بـ PTM عن طريق تعريض TN-R لكبريت نسبة وزن معينة (Zamze et al. ، 1999).

يقدر 80 و # 37 من مرضى اصابات النخاع الشوكي بألم واضح يشبه الصدمة الكهربائية أو الحروق (ميهتا وآخرون ، 2019). ألم ما بعد اصابات النخاع الشوكي له تأثير أكثر خطورة على الحياة اليومية للمرضى من خلل الحركة ، ويمكن أن يقلل بشكل خطير من نوعية الحياة (Finnerup et al.، 2001). الآليات المعقدة تكمن وراء آلام الاعتلال العصبي ، وقد أكد بعض الباحثين أن اصابات النخاع الشوكي تسبب فقدان الدوائر المثبطة في القرن الظهري للجزء التالف ، بحيث تتطور إشارات مسببة للألم شديدة النشاط وتؤدي إلى زيادة الحساسية للألم (فرط التألم) وفرط الحساسية الميكانيكية ( allodynia) (Meisner et al. ، 2010). وقد طرح بعض الباحثين أيضًا فرضية اللدونة غير القادرة على التكيف للجهاز العصبي المركزي ، والتي تنص على أن اللدونة غير القادرة على التكيف هي السبب الرئيسي لألم الأعصاب في إصابات النخاع الشوكي. يعتقد باحثون آخرون أن فسفرة ERK بوساطة مستقبلات D1 / 5 تتضاءل بعد اصابات النخاع الشوكي ، وأن مستقبلات الدوبامين D1 تضيع في المادة الرمادية المحيطة بالقناة (Voulalas et al. ، 2017).

Garcia-Larrea et al. (2013) أفاد أن الأفراد الذين يعانون من آلام الأعصاب غالبًا ما يظهرون نشاطًا مفرطًا للقشرة المعزولة. يتأثر الانتقال المشبكي الاستثاري للقشرة المعزولة بمستقبلات حمض & # 945-أمين-3-هيدروكسي-5-ميثيل-4-إيزوكسازوليبروبيونيك (AMPAR). غالبًا ما تكون وظيفة AMPAR للقشرة المعزولة مفرطة النشاط في الأفراد الذين يعانون من آلام الأعصاب (Koga et al. ، 2012). كيو وآخرون. (2014) ذكر أن وفرة GluA1 المشبكي ، وهي الوحدة الفرعية لـ AMPAR ، تزداد بعد اصابات النخاع الشوكي ، وأن الفسفرة لـ GluA1 في Slu845 مطلوبة لتعزيز AMPARs المشبكي. لذلك ، من الواضح أن فسفرة GluA1 لها تأثير مهم على آلام الأعصاب في القشرة المعزولة. هناك أيضًا علاقة وثيقة بين تطور آلام الأعصاب ومستوى مستقبلات N-methyl-D-aspartate (NMDA) (NMDARs) في القشرة المعزولة. تشارك الوحدة الفرعية GluN2B في NMDARs في العمليات الفيزيولوجية المرضية مثل إدراك الألم والضرر الإقفاري ، وهي بروتين رئيسي للتيروزين الفسفوري لبروتينات كثافة ما بعد المشبكي في الدماغ. تم الإبلاغ عن أن مستوى الفسفرة للوحدة الفرعية GluN2B في القرن الظهري السطحي للحبل الشوكي يزداد بشكل ملحوظ بعد 7 أيام من اصابات النخاع الشوكي ، وأن فين كيناز يمكنه التوسط في هذه الفسفرة (Abe et al. ، 2005). استخدم بعض الباحثين تقنية الضربة القاضية للجينات لضرب Y1472 في الفئران واستبداله بـ Tyr1472 ، وبالتالي تقليل GluN2B في موقع الفسفرة Y1472 في الجسم. في هذا النموذج ، كان ألم الفئران التي خرجت من دائرة المغلوب أقل بشكل ملحوظ من ألم الفئران التي لم يتم ضربها بالضربة القاضية (ناكازاوا وآخرون ، 2006 كاتانو وآخرون ، 2011). في الختام ، يبدو أن الفسفرة للوحدات الفرعية AMPAR و NMDARs تلعب دورًا مهمًا في ألم الأعصاب.

لقد ثبت أن الحديث المتبادل بين الخلايا الدبقية والخلايا العصبية يرتبط بالعديد من عمليات تطور الجهاز العصبي المركزي ، مثل تكوين الخلايا العصبية ، وتكوين النخاع ، وتكوين المشبك ، والهجرة العصبية ، والتكاثر والتمايز ، والإشارات العصبية (Gomes et al. ، 2001). على سبيل المثال ، الخلايا الدبقية التي يتم تنشيطها بعد اصابات النخاع الشوكي تفرز السيتوكينات المسببة للالتهابات ، والناقلات العصبية ، ROS / RNS ، و ATP ، والتي تحفز بعد ذلك الفسفرة لـ CREB و ERK. هذا PTM يعدل فرط النشاط العصبي الحسي وآلام الأعصاب المركزية بعد اصابات النخاع الشوكي (Crown et al. ، 2006).

لعدة قرون ، تم بذل جهود متواصلة لتحديد استراتيجية العلاج الأمثل لاصابات النخاع الشوكي ، على الرغم من أن الضعف الوظيفي أمر لا مفر منه. يختلف التشخيص وفقًا لمستويات الإصابة المختلفة ، ويمكن أن يُحدث التجديد المحوري الناجح في مستويين أو أكثر من مستويات العمود الفقري فرقًا كبيرًا للمرضى الذين يعانون من آفة C6 / 7 في الحبل العنقي ، حيث يمكن أن يساعد ذلك في إعادة بعض السيطرة على الحجاب الحاجز وبعضها. درجة التحكم في اليد والأصابع. في العمود الفقري العنقي ، يبلغ ارتفاع كل قطعة شوكية 1 سم ، وبالتالي يصعب على تجديد العصب أن يتجاوز 2 سم. أوضح العقبات التي تحول دون التجديد هي فقدان القدرة على تجديد المحاور الجوهرية والبيئة الخارجية المعادية.

للتغلب على هذه الصعوبات ، قام الباحثون بالتحقيق في فعالية التدخلات الدوائية في اصابات النخاع الشوكي. في الممارسة السريرية ، غالبًا ما يستخدم الطاقم الطبي methylprednisolone ، والذي يمكنه الحفاظ على حاجز الدم في الحبل الشوكي وقمع الالتهاب (Chio et al. ، 2020). أظهرت الأبحاث ذات الصلة أيضًا أن الميثيل بريدنيزولون يمكن أن يسبب أحيانًا ردود فعل سلبية خطيرة مثل الالتهاب الرئوي ونزيف الجهاز الهضمي ، مما قد يؤدي إلى الوفاة في الحالات الشديدة (كو ، 2019). في حين تم إجراء العديد من الدراسات السريرية حول النالوكسون ، والهرمون المطلق للثيروتروبين ، و monosialotetrahexo sylganglioside (Badhiwala et al. ، 2018) ، لم يتم العثور على تحسينات كبيرة. تمت أيضًا دراسة الاستراتيجيات التجريبية الأخرى جيدًا ، مثل انسداد تكوين الندبات الدبقية (Rhodes et al. ، 2004) ، وسد الخراجات والندوب ، والإزالة الانتقائية للخلايا النجمية التفاعلية (Vismara et al. ، 2019) ، وتعديل تثبيط النمو. الجزيئات (Fournier et al. ، 2001) والاستبدال الخلوي (خلايا شوان ، والخلايا الجذعية الجنينية ، والخلايا الجذعية متعددة القدرات ، والخلايا الجذعية الوسيطة ، والخلايا الشمية (Zhao et al. ، 2016 Zavvarian et al. ، 2020) ، والعلاجات الجينية (Uchida) وآخرون. طرق الجمع بين الأدوية المختلفة يمكن أن تساعد في حماية أعصاب مرضى اصابات النخاع الشوكي. كشف تشين وآخرون (2007) أن الوحدة الفرعية لنزع الفسفرة من AMPARs و NMDARs تخفف بشكل كبير من آلام الأعصاب في الفئران ، والتي في يشير إلى أن استهدافًا واحدًا للفسفرة قد ينتج عنه تأثير تآلفي.

لأكثر من 20 عامًا ، تم العثور على chondroitinase ABC لتقليل تثبيط CSPG في النماذج التجريبية من اصابات النخاع الشوكي ، وتستند هذه الطريقة على معرفتنا بالتأثير المثبط لـ CSPG & # 8217s على نمو المحور العصبي بعد اصابات النخاع الشوكي (Zuo et al. ، 1998). ومع ذلك ، فإن CSPGs مهمة أيضًا في تحديد مسار المحور العصبي والتوجيه (شوارتز وآخرون ، 2018). علاوة على ذلك ، تم إجراء غالبية الأبحاث على الحيوانات حول هذا التأثير العلاجي خلال فترة زمنية قصيرة نسبيًا ، من أيام إلى أسابيع ، ولا تزال التحقيقات طويلة المدى غير متوفرة. حتى الآن ، لا تزال الإمكانات السريرية لـ chondroitinase ABC غير واضحة. في الواقع ، فإن إعطاء chondroitinase ABC في اصابات النخاع الشوكي الحاد يؤدي إلى هضم CSPG جذري وغير قابل للانعكاس ، ولم يتم توضيح التأثيرات طويلة المدى في البشر. ومع ذلك ، قد يكون هذا أمرًا مهمًا إذا تمكنا من قمع تأثير CSPG على نمو المحاور فقط والتحكم في هذا التأثير بشكل عكسي. ومن المثير للاهتمام ، وفقًا للعمل الذي تمت مناقشته في هذه المراجعة ، أن tubulin acetyltransferase-1 (& # 945TAT1 acetylation) يتوسط التأثير المثبط لـ CSPG على نمو الأنابيب الدقيقة المحوار. يعد تعديل الأسيتيل هذا قابلاً للانعكاس وله آثار جانبية قليلة ، مما يجعل PTM هذا خيارًا أفضل من استئصال CSPG. بعبارة أخرى ، قد يكون كبت التأثير المحدد للجزيء بشكل عكسي أفضل من كبت الجزيء.

كما ذكر أعلاه ، فإن PTMs ودورها في اصابات النخاع الشوكي ديناميكية للغاية. علاوة على ذلك ، تختلف وظيفة PTM المحددة على بروتين واحد في نقاط زمنية مختلفة وفي بيئات مختلفة. على سبيل المثال ، قد يكون PTM معينًا مفيدًا أثناء الإصابة الأولية بعد اصابات النخاع الشوكي ، ولكنه قد يكون ضارًا عندما يتعلق الأمر بالمرحلة الثانية. وبالتالي ، يجب أن تكون PTM العلاجية قابلة للتنظيم. عادةً ما تكون عملية النسخ وتحرير الحمض النووي الريبي (RNA) والترجمة لا رجعة فيها. لا يمكن تغيير البنية الثلاثية للبروتين و # 8217s إلا من خلال التقلبات التوافقية بعد اختيار exons وتقسيمها. هناك العديد من أجهزة PTM شديدة التنظيم ، وكثير منها يتضمن عمليات عكسية ، في حين أن حالة الفسفرة (غير الفسفرة أو الفسفرة) للجزيء يمكن عكسها. هذا يسلط الضوء على PTMs كأهداف علاجية مثالية وفقًا للمتطلبات العلاجية الزمانية المكانية للاصابات النخاع الشوكي. ميزة أخرى لاستهداف PTMs هي أن التأثيرات فورية نسبيًا لأن التغييرات المرتبطة بـ PTM في بقايا الأحماض الأمينية تعمل على الفور على تحويل نشاط البروتين والمواقع الخلوية والتفاعلات الديناميكية مع البروتينات الأخرى. هذا التأثير في الوقت المناسب مناسب بالنظر إلى التدهور السريع والتحول في العمليات المرضية للاصابات النخاع الشوكي.

بخلاف التطبيقات العلاجية ، يمكن أيضًا استخدام PTMs كعلامة حيوية لـ SCI. كابريللي وآخرون (2019) أفاد أن تاو مفرط الفسفرة والمشقوق يمكن أن يكون مؤشرات حيوية حساسة لإصابة الجهاز العصبي المركزي والتي يمكن أن توفر تقييمًا متسقًا وموثوقًا لوجود وشدة الإصابة والتنبؤ بالشفاء.

على الرغم من مزايا علاج استهداف PTM في اصابات النخاع الشوكي ، يجب ملاحظة حدوده أيضًا. أولاً ، تتنوع أهداف العديد من أجهزة PTM ، مما يجعل من الصعب استهداف هذه الأدوية من الناحية الصيدلانية. ثانيًا ، تختلف وظائف PTM وفقًا للنقاط الزمنية بعد SCI ، ومن الصعب تأكيد الوقت الأمثل لاستهداف أجهزة PTM. أخيرًا ، فشل تجديد الخلايا العصبية بعد اصابات النخاع الشوكي يمكن أن يعزى إلى عدة عوامل ، وقد لا يكون PTM المحدد الذي يعدل فقط القدرة التجديدية الجوهرية أو تكوين الندبة الجزيئية أو الدبقية المثبطة كافياً لضمان الشفاء الهادف.

بالنسبة لمعظم المرضى الذين يعانون من اصابات النخاع الشوكي ، فإن الشفاء التام غير محتمل ويصعب تحقيقه. يجب أن تركز الاستراتيجيات العلاجية على التعافي الوظيفي خطوة بخطوة وعلى تحسين نوعية الحياة ، ويجب أن تعطي التحقيقات في علاج PTM الأولوية للتحكم في آلام الأعصاب على استعادة الحركة أو الاستعادة الحسية. كشف العمل التشجيعي عن دور PTMs في تخفيف آلام الأعصاب. علاوة على ذلك ، تتنوع العوامل التي تعيق تجديد المحاور العصبية ، وبالتالي يجب فحص مجموعة من PTMs التي تستهدف عدة عوامل. علاوة على ذلك ، قد تزيد الاستراتيجيات العلاجية الأخرى ، مثل زرع الخلايا والعلاج الجيني ، بشكل كبير من تأثير التعديل الناجم عن PTM.

الكاتب الاشتراكات: جمع التبرعات وتصميم المخطوطات وصياغتها: SZ، LJL، QC data collection: BSY، SJL، GT data analysis: JYT، GFW، LL، GLC. وافق جميع المؤلفين على النسخة النهائية من الورقة.

تضارب المصالح: الكتاب تعلن أنه ليس لديهم المصالح المتنافسة.

الدعم المالي: تم دعم هذا العمل من قبل مؤسسة العلوم الطبيعية الوطنية في الصين ، رقم 81801210 (إلى SZ).

اتفاقية ترخيص حقوق النشر: تم التوقيع على اتفاقية ترخيص حقوق النشر من قبل جميع المؤلفين قبل النشر.

فحص السرقة الأدبية: فحصه مرتين بواسطة iThenticate.

استعراض النظراء: استعراض الأقران خارجيا.

فتح المراجعين الأقران: لوكاس غراسنر ، مركز مورناو للصدمات ، ألمانيا رودولفو غابرييل جاتو ، جامعة إلينوي في شيكاغو ، الولايات المتحدة الأمريكية ميتسوهيرو إينوموتو ، جامعة طوكيو للطب وطب الأسنان ، اليابان.

ملف إضافي: تقارير مراجعة النظراء المفتوحة 1 و 2 و 3[ملف إضافي 1].

التمويل: تم دعم هذا العمل من قبل مؤسسة العلوم الطبيعية الوطنية في الصين ، رقم 81801210 (إلى SZ).

المراجعون P: Grassner L ، Gatto RG ، Enomoto M C-Editors: Zhao M ، Qiu Y T-Editor: Jia Y


الملخص

الخيوط الوسيطة (IFs) هي هياكل هيكلية خلوية وهياكل هيكلية توفر مرونة ميكانيكية ومقاومة للتوتر للخلايا ، وتساهم في الوظائف البيولوجية تحت الخلوية والخاصة بالأنسجة ، وتسهل التواصل داخل الخلايا. يتم تنظيم IFs ، بما في ذلك اللامينات النووية وتلك الموجودة في السيتوبلازم (الكيراتين ، والفيمنتين ، والديزمين ، والخيوط العصبية والبروتين الحمضي الليفي الدبقي ، من بين أمور أخرى) ، وظيفيًا عن طريق تعديلات ما بعد الترجمة (PTMs). تسلط التطورات البروتينية الضوء على التعقيد الهائل والإمكانات التنظيمية لـ PTMs لبروتين IF ، والتي تشمل الفسفرة ، والجليكوزيل ، والسومويليشن ، والأستلة ، والسبيل ، مع زيادة تقدير التعديلات الجديدة. سوف تحتاج الدراسات المستقبلية إلى توصيف آليات التشغيل والإيقاف والتحدث المتبادل والمنفعة باعتبارها مؤشرات حيوية وأهدافًا للأمراض التي تنطوي على الهيكل الخلوي IF.


بروتينات Hyp / Pro-rich

مثل EXTs و AGPs ، تنتمي H / PRPs إلى عائلة HRGP الفائقة وبعضها عبارة عن بروتينات خيمرية. كما ذكر أعلاه ، لا يُعرف الكثير عن ا-الجليكوزيل لـ H / PRPs وتفاعلاتها مع السكريات. فيما يتعلق ب ا-الغليكوزيل ، المعلومات متاحة فقط لـ H / PRPs التي تحتوي على X (Pro / Hyp)ن & # x02265 2الزخارف X. يمكن أن يرتبط هذا النوع من المجال بنطاق AGP قصير N-terminal ، وامتداد هيستيدين (His) و C-terminal PAC (بروتين غني بالبرولين و AGP ، يحتوي على Cys) كما هو الحال في A. thaliana AtAGP31 (ليو ومهدي ، 2007 حجازي وآخرون ، 2012). حتى الآن ، تم تحديد اثني عشر من هذه البروتينات في A. thaliana, دوقوس كاروتا, جوسيبيوم هيرسوتوم, نيكوتيانا الااتا, ن. تاباكوم, فاسولوس، فولغاريس, الفليفلة الحولية و هجين البطونية (حجازي وآخرون ، 2014).

هيكل ا-جليكانات H / PRPs من نوع AtAGP31

اتتميز أشكال الأحماض الأمينية الجليكوزيلاتي في مجال H / PRP لـ AtAGP31 بمقياس الطيف الكتلي: Lys (Ala / Ser) HypVal ، Lys (Pro / Hyp) (Hyp / Pro) (Thr / Val) ، Thr (Pro / Hyp ) (Hyp / Pro) Val، and Tyr (Pro / Hyp) (Hyp / Pro) Thr (Hijazi et al.، 2012). السكاريد الأحادي المرتبط بـ Hyp هو عبارة عن hexose وهو على الأرجح غال استنادًا إلى تحليل أحادي السكاريد للبروتين المنقى (53.2٪ Gal ، 39.5٪ Ara ، 2.2٪ Xyl ، 1.9٪ Fuc ، 1.8٪ Glc ، 1.3٪ Man ، 0.3٪ جلكوا). وتجدر الإشارة إلى أن هذا التحليل الشامل يشمل ا-glycans المرتبطة بمجال AGP لـ AtAGP31 و ن-glycans مرتبطة بنطاق PAC الخاص بها. ال ا-Glycan المرتبط بمجال H / PRP لـ AtAGP31 لم يتم التعرف عليه بواسطة كاشف & # x003b2-D-glucosyl Yariv ، لكنه يتفاعل مع Peanut Agglutinin (PNA) ، وهو محاضرة ذات تقارب كبير لبقايا Gal (Hijazi et al. . ، 2012). كان يسمى Gal / Ara-rich motif (حجازي وآخرون ، 2012). نيكوتيانا الااتا يشترك NaPRP4 في نفس النوع من مجال H / PRP ومجال PAC مع AtAGP31 (Sommer-Knudsen et al. ، 1996). السكاريد السائد من هذا ا-بروتين سكري هو غال (83٪) بينما آرا ، جلكناك ، مان ، زيل بكميات قليلة (7 ، 4 ، 4 ، 1٪ على التوالي). أظهر تحليل الارتباط وجود محطة AraF (6٪) محطة غالص (48٪) ، 1،3-غالص (4٪) ، 1،6-جالونص (14٪) ، 1،3،6 غالص (25٪) ، 1،2 رجلص (1٪) وزيلص (1٪). إجمالاً ، H / PRPs مع X (Pro / Hyp)ن & # x02265 2الزخارف X هي ا-جليكوزيلاتي مع جليكانات Gal-Ara الغنية والتي تبدو مختلفة قليلاً عن الأنواع الموصوفة سابقًا من النوع الأول والثاني والثالث. ستكون هناك حاجة إلى مزيد من التوصيف ، خاصة عن طريق الرنين المغناطيسي النووي ، لوصف هذه الهياكل بشكل كامل.

تفاعلات H / PRPs مع السكريات

يُفترض أن H / PRPs متشابكة في جدران الخلية ، لكن الدليل المباشر لا يزال غير موجود (Bradley et al. ، 1992 Brisson et al. ، 1994 Frueauf et al. ، 2000). لا شيء معروف عن الأدوار المحتملة لـ ا- الجليكوزيلات. تم اقتراح AtAGP31 مؤخرًا للمشاركة في شبكات التفاعلات غير التساهمية (حجازي وآخرون ، 2014). بشكل ثابت وعلى عكس HRGPs التي لا يتم حلها تساهميًا في جدران الخلايا ، يتم استخراج AtAGP31 بسهولة من جدران الخلايا من hypocotyls (Hijazi et al. ، 2012). وتجدر الإشارة إلى أن NaPRP4 غير قابل للذوبان في جدران الخلايا أيضًا (Sommer-Knudsen et al. ، 1996). تم عرض AtAGP31 للتفاعل في المختبر مع فروع RGI من النوع الأول AG من خلال مجال PAC الخاص بها ومع حمض polygalacturonic الميثيل ، ربما من خلال امتداده. تم افتراض تفاعلات البروتين / البروتين أيضًا في AtAGP31 ، مع (1) الاعتراف الذاتي بين مجال PAC الخاص به ومجال H / PRP الخاص به ا-جليكانات ، و (2) التفاعل مع محاضرات جدار الخلية. تم اقتراح أن ينتج عن تنظيم AtAGP31 متعدد المجالات سقالات فوق جزيئية معقدة بمكونات مختلفة لجدار الخلية ، مما يساهم في تقوية جدران الخلايا للأعضاء سريعة النمو مثل hypocotyls. لم يتم وصف هذه الشبكات غير التساهمية من قبل لـ HRGPs. قد يوجد سلوك مشابه للبروتينات التي تشترك في الميزات مع AtAGP31 (حجازي وآخرون ، 2014). ومع ذلك ، كما ذكر أعلاه ، باستثناء NaPRP4 الذي تم تمييز ارتباطه بالجليكوزيل (Sommer-Knudsen et al. ، 1996) ، لم يتم وصف هذه البروتينات على المستوى الجزيئي ولم يتم التحقيق في تفاعلاتها مع عديدات السكاريد الموجودة في جدار الخلية. TTS-1 و TTS-2 (إرسال الأنسجة الخاصة) من ن. تاباكومو DcAGP1 من D. كاروتا أظهرت أنها تعرض شكلًا إهليلجيًا وأن تتجمع ذاتيًا في هياكل عالية المستوى باستخدام تقنيات الفحص المجهري (Baldwin et al. ، 2000 ، 2001 Wu et al. ، 2001). ومن المثير للاهتمام ، أن إزالة الجليكوزيل في TTS يعطل قدرتها على التجميع ، مما يشير إلى تنظيم للارتباط الذاتي من خلال مستوى ا- الارتباط بالجليكوزيل (وو وآخرون ، 1995). التجميع الذاتي بطريقة وجها لوجه من خلال التفاعلات بين ايمكن اقتراح -glycans لمجال H / PRP ومجال PAC للبروتينات مثل TTS و DcAGP1 ، على غرار AtAGP.


محتويات

الإضافة بواسطة إنزيم في الجسم الحي يحرر

مجموعات كارهة للماء من أجل توطين الغشاء تحرير

    (نوع من الأسيلة) ، مرفق ميريستات ، أ ج14 حمض مشبع (نوع من الأسيلين) ، ارتباط بالميتات ، أ ج16 حمض مشبع أو prenylation ، إضافة مجموعة isoprenoid (مثل farnesol و geranylgeraniol)

العوامل المساعدة لتعزيز النشاط الأنزيمي تحرير

    (نوع من acylation) ، مرفق ليبوات (C.8) قد يتم ربط جزء المجموعة الوظيفية (FMN أو FAD) تساهميًا عبر روابط thioether مع cysteines ، إضافة جزء 4'-phosphopantetheinyl من الإنزيم المساعد A ، كما هو الحال في الأحماض الدهنية ، والبوليكيتيد ، والببتيد غير الريبوسومي ، والتخليق الحيوي لليوسين.

تعديلات عوامل الترجمة تحرير

    تكوين (على الهيستدين الموجود في eEF2) مرفق (على الغلوتامات الموجود في eEF1α) [8] تشكيل (على ليسين محفوظ لـ eIF5A (حقيقيات النوى) و aIF5A (أثرى)) بالإضافة إلى ليسين محفوظ لعامل الاستطالة P (EFP) في معظم البكتيريا. [9] EFP هو نظير لـ eIF5A (حقيقيات النوى) و aIF5A (عتيق) (انظر أعلاه).

مجموعات كيميائية أصغر

    ، على سبيل المثال ا-اكيليشن (استرات) ، ن-اكيليشن (أميدات) ، س-اكيليشن (ثيويستر)
      ، إضافة مجموعة أسيتيل ، إما عند الطرف N [10] للبروتين أو في بقايا اللايسين. [11]انظر أيضا أستلة هيستون. [12] [13] والعكس يسمى نزع الأسيتيل.
      إضافة مجموعة الميثيل ، عادة في بقايا ليسين أو أرجينين. يسمى العكس بإزالة الميثيل.
      إضافة
        ، إضافة إلى الوساطة tRNA ، الارتباط التساهمي لبقايا حمض الجلوتاميك مع الطرف N من توبولين وبعض البروتينات الأخرى. [15] (انظر tubulin polyglutamylase) ، الارتباط التساهمي من واحد إلى أكثر من 40 من بقايا الجلايسين إلى الذيل الطرفي لتوبيولين C
        ، بالإضافة إلى ن- أسيتيل جلوكوزامين إلى بقايا سيرين أو ثريونين في ارتباط بيتا-جليكوسيد.
      • polysialylation ، إضافة حمض polysialic ، PSA ، إلى NCAM
        ، إضافة مجموعة الفوسفات ، عادة إلى سيرين ، ثريونين ، وتيروزين (ا- مرتبطة) ، أو هيستيدين (نمرتبط) ، إضافة جزء من الأدينيل ، عادةً إلى التيروزين (ا- مرتبطة) ، أو الهيستيدين والليسين (ن-مرتبط)
      • uridylylation ، إضافة مجموعة uridylyl (أي uridine monophosphate ، UMP) ، عادةً إلى tyrosine

      الإضافات غير الأنزيمية في الجسم الحي يحرر

        ، إضافة جزيء السكر إلى البروتين دون التأثير المسيطر للإنزيم. إضافة حمض Isocyanic إلى الطرف N للبروتين أو السلسلة الجانبية لـ Lys. [18] إضافة أول أكسيد الكربون إلى مركبات عضوية / غير عضوية أخرى.
      • تكوين رابطة الأيزوببتيد العفوي ، كما هو موجود في العديد من البروتينات السطحية للبكتيريا إيجابية الجرام. [19]

      الإضافات غير الأنزيمية في المختبر يحرر

        : الارتباط التساهمي لشق البيوتين باستخدام كاشف biotinylation ، عادةً لغرض تمييز البروتين.
      • الكارباميل: إضافة حمض الإيزوسيانيك إلى الطرف N للبروتين أو السلسلة الجانبية لبقايا Lys أو Cys ، والتي تنتج عادةً عن التعرض لمحاليل اليوريا. [20]
      • الأكسدة: إضافة ذرة أكسجين واحدة أو أكثر إلى سلسلة جانبية حساسة ، بشكل أساسي من بقايا Met أو Trp أو His أو Cys. تشكيل روابط ثاني كبريتيد بين مخلفات السيستئين. : التعلق التساهمي لبولي إيثيلين جلايكول (PEG) باستخدام كاشف ربط ، عادةً إلى الطرف N أو السلاسل الجانبية لبقايا Lys. يستخدم Pegylation لتحسين فعالية الأدوية البروتينية.
      • ISGylation ، الارتباط التساهمي ببروتين ISG15 (الجين المحفز للإنترفيرون 15) [21] ، الارتباط التساهمي ببروتين SUMO (المودر الصغير المرتبط بـ Ubiquitin) [22] ، الارتباط التساهمي ببروتين يوبيكويتين. ، الارتباط التساهمي بـ Nedd ، الرابط التساهمي بالبروتين الشبيه باليوبيكويتين بدائية النواة
        ، أو الإله، وتحويل الأرجينين إلى سيترولين [23] ، وتحويل الجلوتامين إلى حمض الجلوتاميك أو الأسباراجين إلى حمض الأسبارتيك ، والتحويل إلى ألكين عن طريق إزالة بيتا من الفوسفوثريونين والفوسفوسرين ، أو تجفيف الثريونين والسيرين [24]
        ، الارتباط التساهمي بين اثنين من الأحماض الأمينية السيستين ، وانقسام البروتين في تكوين رابطة الببتيد ، عن طريق تحلل الأسباراجين أو بقايا الأحماض الأمينية من حمض الأسبارتيك
        • سيرين بواسطة بروتين سيرين إبيميراز
        • من الألانين في الديرمورفين ، وهو ببتيد أفيوني للضفدع
        • من الميثيونين في دلتورفين ، وهو أيضًا ببتيد أفيوني للضفدع

        PTMs المشتركة عن طريق تحرير التردد

        في عام 2011 ، تم تجميع إحصاءات كل تعديل لاحق للترجمة تجريبيًا واكتشافًا مفترضًا باستخدام معلومات على مستوى البروتين من قاعدة بيانات Swiss-Prot. [25] كانت التعديلات العشرة الأكثر شيوعًا التي تم العثور عليها تجريبياً كما يلي: [26]

        تكرر تعديل
        58383 الفسفرة
        6751 أستلة
        5526 الارتباط بالجليكوزيل المرتبط بـ N
        2844 وسط
        1619 الهيدروكسيل
        1523 مثيلة
        1133 الارتباط بالجليكوزيل المرتبط بـ O
        878 التواجد في كل مكان
        826 حمض الكربوكسيل بيروليدون
        504 الكبريت

        PTMs الشائعة عن طريق تحرير المخلفات

        بعض التعديلات الشائعة اللاحقة للترجمة على بقايا حمض أميني محددة موضحة أدناه. تحدث التعديلات على السلسلة الجانبية ما لم يُذكر خلاف ذلك.

        حمض أميني أبريف. تعديل
        ألانين علاء N- أستلة (N- نهاية)
        أرجينين أرج التقليل من سيترولين ، مثيلة
        الهليون أسن deamidation إلى Asp أو iso (Asp) ، الارتباط بالجليكوزيل المرتبط بـ N
        حمض الأسبارتيك آسيا والمحيط الهادئ الأيزومرة لحمض الأيزوبارتيك
        سيستين السيستئين تشكيل رابطة ثاني كبريتيد ، أكسدة حامض السلفينيك أو حمض السلفونيك أو حمض السلفونيك ، بالميتويليشن ، N- أسيتيل (N- نهاية) ، S- نتروزيل
        الجلوتامين جلن التحلل إلى حمض البيروجلوتاميك (N-terminus) ، أو تخريب حمض الجلوتاميك أو تكوين رابطة الأيزوببتيد إلى ليسين بواسطة ترانسجلوتاميناز
        حمض الجلوتاميك غلو التدوير إلى حمض البيروجلوتاميك (N-terminus) ، جاما الكربوكسيل
        جليكاين جلاي N- Myristoylation (N- نهاية) ، N- أسيتيل (N- نهاية)
        الهيستيدين له الفسفرة
        إيسولوسين إيل
        يسين ليو
        ليسين ليس الأستلة ، التبول ، SUMOylation ، المثيلة ، الهيدروكسيل
        ميثيونين التقى N-acetylation (N-terminus) أو التكاثر المرتبط بـ N أو الأكسدة إلى أكسيد السلفون أو السلفون
        فينيل ألانين Phe
        البرولين طليعة الهيدروكسيل
        سيرين سر الفسفرة ، الارتباط بالجليكوزيل المرتبط بـ O ، N-acetylation (N-terminus)
        ثريونين Thr الفسفرة ، الارتباط بالجليكوزيل المرتبط بـ O ، N-acetylation (N-terminus)
        تريبتوفان TRP أحادي أو ثنائي الأكسدة ، تشكيل كينورينين ، تريبتوفان تريبتوفيلكوينون
        تيروزين صور الكبريتات ، الفسفرة
        فالين فال N- أستلة (N- نهاية)

        تحتوي تسلسلات البروتين على أشكال متسلسلة يتم التعرف عليها عن طريق تعديل الإنزيمات ، والتي يمكن توثيقها أو توقعها في قواعد بيانات PTM. مع اكتشاف عدد كبير من التعديلات المختلفة ، هناك حاجة لتوثيق هذا النوع من المعلومات في قواعد البيانات. يمكن جمع معلومات PTM من خلال الوسائل التجريبية أو التنبؤ بها من بيانات عالية الجودة منسقة يدويًا. تم إنشاء العديد من قواعد البيانات ، غالبًا مع التركيز على مجموعات تصنيفية معينة (مثل البروتينات البشرية) أو ميزات أخرى.

        قائمة الموارد تحرير

          [28] - قاعدة بيانات للمعلومات والأدوات الشاملة لدراسة تعديل ما بعد الترجمة لبروتين الثدييات [29] - قاعدة بيانات للبروتينات والتعديلات اللاحقة للترجمة تجريبيًا [29] - قاعدة بيانات للتعديلات المختلفة وفهم البروتينات المختلفة ، الفئة والوظيفة / العملية المتعلقة بالبروتينات المسببة للأمراض [30] - قاعدة بيانات لأنماط الإجماع للعديد من أنواع PTM بما في ذلك المواقع (PIR) [31] - قاعدة بيانات للحصول على مجموعة من التعليقات التوضيحية والهياكل لـ PTM. [27] - تحتوي قاعدة البيانات التي تُظهر وحدات PTM المختلفة والمعلومات المتعلقة بمكوناتها / هياكلها الكيميائية وتكرار الموقع المعدل للأحماض الأمينية على معلومات PTM على الرغم من أن ذلك قد يكون أقل شمولاً من قواعد البيانات الأكثر تخصصًا.

        أدوات التحرير

        قائمة البرامج لتصور البروتينات و PTMs الخاصة بهم

          [34] - تقديم مجموعة من PTM الشائعة في نماذج البروتين [35] - أداة تفاعلية لمعرفة دور الأشكال المتعددة للنيوكليوتيدات المفردة في PTM [36] - قاعدة البيانات التفاعلية لتصور الجزيئات
        • انشقاق وتشكيل جسور ثاني كبريتيد أثناء إنتاج الأنسولين
        • PTM للهيستونات كتنظيم للنسخ: التحكم في بوليميراز الحمض النووي الريبي بواسطة بنية الكروماتين
        • PTM لـ RNA polymerase II كتنظيم للنسخ
        • انقسام سلاسل البولي ببتيد كأمر حاسم لخصوصية الليكتين [37]

        السمة الرئيسية للإدمان هي استمراره. يمكن أن يستمر النمط الظاهري الذي يسبب الإدمان مدى الحياة ، مع الرغبة الشديدة في تعاطي المخدرات والانتكاس حتى بعد عقود من الامتناع عن ممارسة الجنس. [38] التعديلات اللاحقة للترجمة والتي تتكون من تعديلات فوق جينية لذيول بروتين هيستون في مناطق معينة من الدماغ تبدو حاسمة بالنسبة للأساس الجزيئي للإدمان. [38] [39] [40] بمجرد حدوث تعديلات جينية ما بعد متعدية ، يبدو أنها "ندوب جزيئية" طويلة الأمد قد تكون مسؤولة عن استمرار الإدمان. [38] [41]

        عادة ما يكون مدخنو السجائر (حوالي 21٪ من سكان الولايات المتحدة في عام 2013) [42]) مدمنين على النيكوتين. [43] بعد 7 أيام من علاج الفئران بالنيكوتين ، تمت زيادة التعديلات اللاحقة للترجمة المكونة من أستلة كل من هيستون H3 وهيستون H4 في محفز FosB في النواة المتكئة للدماغ ، مما تسبب في زيادة بنسبة 61٪ في تعبير FosB. [44] يؤدي هذا أيضًا إلى زيادة التعبير عن متغير لصق Delta FosB. في نواة الدماغ المتكئة ، يعمل Delta FosB كـ "مفتاح جزيئي مستدام" و "بروتين تحكم رئيسي" في تطوير الإدمان. [45] [46] وبالمثل ، بعد 15 يومًا من علاج الجرذان بالنيكوتين ، يحدث التعديل اللاحق للترجمة المكون من 3 أضعاف أستلة هيستون H4 عند محفز جين مستقبل الدوبامين D1 (DRD1) في قشرة الفص الجبهي ( PFC) من الفئران. تسبب هذا في زيادة إفراز الدوبامين في منطقة الدماغ المرتبطة بمكافأة PFC ، وتم التعرف على زيادة إفراز الدوبامين كعامل مهم للإدمان. [47] [48]

        حوالي 7٪ من سكان الولايات المتحدة مدمنون على الكحول. في الجرذان التي تعرضت للكحول لمدة تصل إلى 5 أيام ، كانت هناك زيادة في التعديل اللاحق للترجمة لـ هيستون 3 ليسين 9 أسيتيل ، H3K9ac ، في محفز البروكيسيبتين في مجمع اللوزة الدماغية. هذا الأسيتيل هو علامة تنشيط للبروكسيسبتين. ويشارك نظام مستقبلات nociceptin / nociceptin الأفيونية في تعزيز أو تكييف تأثيرات الكحول. [49]

        يحدث إدمان الكوكايين في حوالي 0.5٪ من سكان الولايات المتحدة. يؤدي تعاطي الكوكايين المتكرر في الفئران إلى إجراء تعديلات ما بعد الترجمة بما في ذلك فرط أسيتيل هيستون 3 (H3) أو هيستون 4 (H4) عند 1696 جينًا في منطقة مكافأة دماغية واحدة [النواة المتكئة] وإزالة الأسيتيل عند 206 جينات. [50] [51] تم العثور على ما لا يقل عن 45 جينًا ، ظهر في دراسات سابقة أنه يتم تنظيمها في النواة المتكئة للفئران بعد التعرض المزمن للكوكايين ، على أنها مرتبطة بفرط أسيتيل الهيستون H3 أو هيستون H4 بعد الترجمة. ترتبط العديد من هذه الجينات الفردية ارتباطًا مباشرًا بجوانب الإدمان المرتبطة بالتعرض للكوكايين. [51] [52]

        في عام 2013 ، احتاج 22.7 مليون شخص في سن 12 عامًا أو أكثر في الولايات المتحدة إلى علاج لمشكلة تعاطي المخدرات أو الكحول (8.6 في المائة من الأشخاص الذين تبلغ أعمارهم 12 عامًا أو أكثر). [42]


        العنوان الحالي: العنوان الحالي: قسم الكيمياء ، جامعة إنديانا ، بلومنجتون ، إنديانا ، الولايات المتحدة الأمريكية.،

        ميجان موريس وجيزيل إم كنودسن: ساهم هذان المؤلفان بالتساوي في هذا العمل.

        الانتماءات

        معهد جلادستون للأمراض العصبية ، سان فرانسيسكو ، كاليفورنيا ، الولايات المتحدة الأمريكية

        ميجان موريس ، سوميهيرو مايدا وأمبير لينارت موك

        قسم الكيمياء الحيوية ، الكيمياء الحيوية ، برنامج الدراسات العليا في البيولوجيا الخلوية والجزيئية ، كلية الطب بجامعة جونز هوبكنز ، بالتيمور ، ماريلاند ، الولايات المتحدة الأمريكية

        قسم الكيمياء الصيدلية ، مرفق مطياف الكتلة ، جامعة كاليفورنيا ، سان فرانسيسكو ، كاليفورنيا ، الولايات المتحدة الأمريكية

        جيزيل إم كنودسن ، جوناثان سي ترينيداد ، ألكسندرا يوانوفيجيو وأمبير ألما إل بورلينجيم

        قسم طب الأعصاب ، جامعة كاليفورنيا ، سان فرانسيسكو ، كاليفورنيا ، الولايات المتحدة الأمريكية

        سوميهيرو مايدا وأمبير لينارت موك

        يمكنك أيضًا البحث عن هذا المؤلف في PubMed Google Scholar

        يمكنك أيضًا البحث عن هذا المؤلف في PubMed Google Scholar

        يمكنك أيضًا البحث عن هذا المؤلف في PubMed Google Scholar

        يمكنك أيضًا البحث عن هذا المؤلف في PubMed Google Scholar

        يمكنك أيضًا البحث عن هذا المؤلف في PubMed Google Scholar

        يمكنك أيضًا البحث عن هذا المؤلف في PubMed Google Scholar

        يمكنك أيضًا البحث عن هذا المؤلف في PubMed Google Scholar

        مساهمات

        مم. صمم وأجرى تجارب الماوس والتحليلات الإحصائية وكتب المخطوطة. ج. حلل ورعاية بيانات رسم الخرائط PTM ، وأجرى تجارب قياس الطيف الكتلي الكمي وكتب المخطوطة. م. أجرى تجزئة PSD والبقع الغربية ، وكتب المخطوطة. ج. ساعد في تطوير طريقة قياس الطيف الكتلي وكتب المخطوطة. أ. أجريت تجارب رسم الخرائط PTM بواسطة مطياف الكتلة. أ. وأشرف ل.م. على المشروع وكتب المخطوطة.

        المؤلف المراسل


        المواد والأساليب

        تستخدم iPTMnet إطار عمل تكامليًا للمعلومات الحيوية (الشكل 1) لربط المعلومات من قواعد بيانات المعلومات الحيوية المتباينة ونتائج التنقيب عن النصوص والأنطولوجيا في شبكات PTM للاستكشاف والاكتشاف. مكونات النظام الرئيسية هي: (1) نظام التنقيب عن النص (انظر 2.1) (2) معلومات PTM من قواعد البيانات المنسقة من الخبراء (انظر 2.2) (3) علم الوجود البروتيني للتمثيل البروتيني داخل الأنواع وعبرها (انظر 2.3) و (4) قاعدة معارف iPTMnet وبوابة الويب (انظر 2.6). بشكل عام ، توفر iPTMnet معلومات عن ثمانية أنواع مهمة من PTM - الفسفرة ، التواجد في كل مكان ، الأسيتيل ، الميثيل ، الارتباط بالجليكوزيل ، النتروزيل S ، السومويليشن والميريستول - في الإنسان والعديد من الكائنات الحية النموذجية.

        مكونات نظام iPTMnet. (1) نظام التنقيب عن النصوص لاستخراج معرفة PTM من المؤلفات العلمية (2) معلومات PTM من قواعد بيانات عالية الجودة منسقة يدويًا (3) قواعد بيانات لتمثيل المعرفة و (4) قاعدة معارف iPTMnet بمعلومات متكاملة وبوابة ويب تربط مكونات النظام بـ دعم الاستفسارات العلمية التفاعلية وتصور البيانات لـ PTMs.

        مكونات نظام iPTMnet. (1) نظام التنقيب عن النصوص لاستخراج معرفة PTM من المؤلفات العلمية (2) معلومات PTM من قواعد بيانات عالية الجودة منسقة يدويًا (3) قواعد بيانات لتمثيل المعرفة و (4) قاعدة معارف iPTMnet بمعلومات متكاملة وبوابة ويب تربط مكونات النظام بـ دعم الاستفسارات العلمية التفاعلية وتصور البيانات لـ PTMs.

        استخراج النص الكامل لمعلومات PTM من الأدب

        لقد أنشأنا سير عمل آليًا للمعالجة الكاملة لجميع ملخصات PubMed والمقالات الكاملة لمجموعة PubMed Central Open Access (PMCOA) مع RLIMS-P و eFIP ، والتي تم تقييمها مسبقًا للأداء وسهولة الاستخدام في تحديات المجتمع (21) - 24). يتم تخزين نتائج التنقيب عن النص في قاعدة بيانات محلية ويتم تحديثها على أساس شهري. تتضمن المعلومات المخزنة كلاً من الكيانات (مثل الركيزة والموقع والمتفاعل) والعلاقات (على سبيل المثال ، موقع kinase-substrate و PPI) جنبًا إلى جنب مع الأدلة المقابلة في النص (مثل الجمل ومعرفات الأقسام ومعرفات PubMed (PMIDs)). يتم تمييز النص المشروح بالمصطلحات الرئيسية لإسناد الأدلة. في حالة النص الكامل ، نستخدم فقط المعلومات المستخرجة من قسم النتائج لزيادة احتمالية دعم المعلومات بأدلة تجريبية في المقالة. لدمج نتائج التنقيب عن النص في iPTMnet ، نستخدم PubTator (25) الذي يسترد معرفات جينات NCBI المرتبطة بالبروتين / الجينات المذكورة.

        معلومات PTM من قواعد البيانات المنسقة

        تدمج iPTMnet معلومات PTM من العديد من الموارد المنسقة من الخبراء والتي تغطي بيانات الإنتاجية المنخفضة والعالية من مجموعة من الكائنات الحية: (1) PhosphoSitePlus (PSP): معلومات PTM المنسقة من قبل الخبراء بما في ذلك الفسفرة ، والتواجد في كل مكان ، والأستلة والمثيلة بشكل أساسي للإنسان والجرذان و بروتينات الفأر (6) (2) Phospho.ELM: قاعدة بيانات منسقة من قبل خبراء لمواقع الفسفرة في البروتينات الحيوانية (11) (3) PhosPhAt: مواقع فسفرة البروتين المحددة بواسطة مطياف الكتلة في نبات الأرابيدوبسيس thaliana (4) PhosphoGrid: تم التحقق منه تجريبياً في مواقع فسفرة البروتين في الجسم الحي في خميرة الخميرة (26) (v) PomBase: قاعدة بيانات شاملة لخميرة الانشطار شيزوساكارومايس بومب، توفير التعليقات التوضيحية الهيكلية والوظيفية ، وتنظيم الأدبيات والوصول إلى مجموعات البيانات واسعة النطاق (17) (6) UniProtKB: قاعدة بيانات بروتينية شاملة يحتوي فيها القسم الذي تمت مراجعته على معلومات مشروحة من الخبراء من الأدبيات ، بما في ذلك ميزات تسلسل PTM (27) (vii) ) P3DB: بيانات فسفرة البروتين من نباتات متعددة مستمدة من تجارب واسعة النطاق والأدب (14) (viii) neXtProt: قاعدة معرفة البروتين البشري (16) مع البروتينات المنسقة وبيانات التباين الجيني ، لا سيما على كينازات ix) HPRD: PTMs و علاقات الركيزة الإنزيمية للبروتينات البشرية (28) (x) Signor: قاعدة بيانات للعلاقات السببية بين الكيانات البيولوجية ، بما في ذلك علاقات الركيزة الخاصة بإنزيم PTM (29) و (xi) dbSNO: قاعدة بيانات تدمج السيستين S-nitrosylation الذي تم التحقق منه تجريبياً مواقع من أنواع متعددة (30). لم تعد بعض قواعد البيانات هذه ترعى أوراقًا جديدة بنشاط. من خلال تضمينهم في iPTMnet ، يمكننا الحفاظ على مساهمتهم القيمة ونشرها. نحافظ على سلامة هذه البيانات من خلال عمليات التحقق من صحة الموقع / التسلسل ومراقبة المقالات التي تم سحبها حتى نتمكن من تصحيح المعلومات أو إزالتها حسب الضرورة.

        تنظيم البروتينات والبروتينات PTM باستخدام PRO

        يشكل PRO جزءًا مهمًا من مجموعة بيانات iPTMnet لأنه يضع معلومات موقع PTM في سياق الأشكال البروتينية ، أي أنه يُظهر مجموعة PTM التي تمت ملاحظتها في بروتين معين. هذه الميزة المتمثلة في تمثيل مجموعات تم التحقق من صحتها تجريبياً من PTMs فريدة من نوعها. يستخدم PRO تمثيلًا هرميًا (عائلة ← جين ← تسلسل ← تعديل) يصور علاقات البروتين بفئته الأصلية والأشكال الإسوية والبروتينية التابعة للطفل. يربط التسلسل الهرمي للمحترفين أيضًا الشكل البروتيني المحدد للبروتين عبر الأصناف عندما يتم ملاحظة تعديل مماثل للبروتين المحفوظ تجريبياً في كائنات متعددة. علاوة على ذلك ، يوفر PRO عددًا وفيرًا من الركيزة الإنزيمية PTM برعاية الخبراء وعلاقات PPI المعتمدة على PTM.

        يتم تخزين جميع بيانات PRO في قاعدة بيانات منفصلة ، يستهلك iPTMnet جزءًا منها فقط. يتم سحب المعلومات الوصفية لكل إدخال PRO مثل الاسم والتعريف والتسمية مباشرة من قاعدة بيانات PRO. يتم استخراج العلاقات الهرمية PTM و PPI و PRO وإعادة تنسيقها قبل استيرادها إلى iPTMnet ، على النحو التالي: (1) بالنسبة إلى الأشكال البروتينية لـ PTM الخاصة بالكائن (فئة PRO: تعديل الكائن الحي) ، نقوم باستخراج الأدلة ، والمرجع إلى مواقع UniProtKB AC و PTM جنبًا إلى جنب مع أنواع PTM المقابلة لها (ممثلة بمعرف PSI-MOD (31) أو UniCarbKB (9)) من تعريف المصطلح. يتم استخراج معلومات إنزيم PTM من سطر تعليق PRO (2) يتم استخراج معلومات PPI المعتمدة على الشكل البروتيني من ملف التعليق التوضيحي PRO. يتم استخراج التعليقات التوضيحية برمز الدليل "IPI" (المستنتج من التفاعل المادي) أو تحت فرع "ارتباط البروتين" مع شريك التفاعل الموثق و 3) يتم استخراج نوعين من العلاقات الهرمية: is_a (علاقة الوالدين بالطفل) و intersection_of (عادةً يستخدم لربط شكل بروتيني بالكائن الحي الموجود فيه).


        هل توجد أي موارد على الإنترنت تحتوي على قائمة بالتعديلات اللاحقة للترجمة ووزنها الجزيئي؟ - مادة الاحياء

        ما هو PIRSF؟
        نظام تصنيف البروتين PIRSF عبارة عن شبكة ذات مستويات متعددة من تنوع التسلسل من العائلات الفائقة إلى العائلات الفرعية التي تعكس العلاقة التطورية للبروتينات والمجالات كاملة الطول. وحدة تصنيف PIRSF الأولية هي عائلة متجانسة الشكل ، وأفرادها متماثلون (نشأوا من سلف مشترك) ومتماثلون (يتشاركون في تشابه تسلسل كامل الطول وبنية مجال مشترك). يتم تنظيم مجموعات البروتين التي يتم إنشاؤها تلقائيًا يدويًا للعضوية وبنية المجال والتعليق التوضيحي لميزات التسلسل والوظائف البيولوجية المحددة والأنشطة الكيميائية الحيوية ، عندما يكون ذلك ممكنًا.

        ماذا في PIRSF بالنسبة لي؟
        تقدم PIRSF عائلات بروتينية منسقة مع قواعد لانتشار الموقع الوظيفي واسم البروتين وتوحيده ، وبالتالي ، تحسين حساسية تحديد البروتين والاستدلال الوظيفي. يوفر البحث في تسلسل البروتين الخاص بك مقابل قاعدة بيانات PIRSF تقييمًا أسرع وأكثر دقة لوظيفتها من بحث BLAST مقابل قاعدة بيانات بروتين غير مشبع. إنه يتجنب المزالق مثل العديد من التعليقات التوضيحية الخاطئة ، وأفضل النتائج بناءً على مجال ثانوي لوظيفة البروتين الرئيسية ، والنتائج الزائفة ، وما إلى ذلك.

        قاعدة بيانات iProClass

        ما هو iProClass؟
        يوفر iProClass وصفًا موجزًا ​​لعائلة البروتين ووظيفته وبنيته لتسلسلات UniProt ، مع روابط لأكثر من 90 قاعدة بيانات بيولوجية (انظر مصادر البيانات). يشتمل iProClass على تقارير لجميع بروتينات UniProtKB وتلك البروتينات الموجودة حصريًا في قاعدة بيانات UniParc.

        البحث عن نص iProClass
        استرجع قائمة مطابقة للتقارير الموجزة عن طريق سلسلة نصية أو معرّف فريد (تحديد حقل من القائمة المنسدلة). انقر فوق الزر "بحث" لاسترداد النتائج. يمكنك فتح مربعات إدخال إضافية في استعلامك بالنقر فوق "إضافة مربع إدخال". انظر تعليمات البحث النصي للحصول على معلومات إضافية.

        مساعدة iProLINK

        • رسم خرائط المراجع: تحديد المقالات من مصادر الأدبيات (مثل PubMed) التي تصف إدخال بروتين معين
        • استخراج التعليقات التوضيحية: تصنيف أنواع التعليقات التوضيحية واستخراج الجمل و / أو العبارات التي تصف التعليق التوضيحي المحدد و
        • تنظيم قاعدة البيانات: تحويل معلومات الأدبيات المستخرجة إلى تعليق توضيحي في قاعدة البيانات باستخدام بناء جملة منظم ، ومفردات مضبوطة ، وإسناد الأدلة.

        رسم الخرائط الببليوجرافية
        يعد ربط مدخلات البروتين بالأدبيات العلمية ذات الصلة التي تصف البروتينات أو تميزها أمرًا بالغ الأهمية لزيادة كمية البيانات التي تم التحقق منها تجريبياً ولتحسين جودة شرح البروتين.
        أدخل سلسلة نصية أو معرفًا فريدًا لاسترداد المراجع المتعلقة باستعلامك.
        تظهر النتائج في جدول مشابه لصفحة نتائج iProClass ، ولكن مع أعمدة محددة تتعلق باسترجاع المراجع. تتوفر روابط إلى سجل الببليوغرافيا وإدخالات PubMed الفردية.
        iProLINK صفحة نتائج تعيين قائمة المراجع لـ UniProtKB P13866

        ميزة إسناد الأدلة
        في قاعدة بيانات PIR-PSD ، يتم تمييز التعليقات التوضيحية للميزات مثل مواقع الربط والمواقع التحفيزية والمواقع المعدلة بعلامات الحالة "تجريبي" أو "وتوقع"للتمييز بين البيانات التي تم التحقق منها تجريبياً والبيانات المتنبأ بها حسابيًا. ولإسناد البيانات الببليوغرافية بشكل مناسب إلى ميزات ذات أدلة تجريبية ، تم إجراء مسح أدبي بأثر رجعي ، والذي يتضمن رسم خرائط الاقتباس (العثور على الاستشهادات من قسم المراجع الذي يصف الميزة التجريبية المحددة) ووضع علامات على الأدلة (وضع علامات على الجمل التي تقدم دليلًا تجريبيًا في مقال ملخص و / أو نص كامل). يتم الآن توسيع هذا ليشمل بروتينات UniProtKB. ابحث عن بروتينات ذات سمة معينة مثل التعديلات اللاحقة للترجمة ، أو أدخل معرف UniProtKB لاسترداد ميزة الإسناد لاستعلامك. في وقت لاحق ، قد تحصل على ببليوغرافيا منسقة تتعلق بالإدخال بالنقر فوق "قائمة المراجع" أو جميع الأدلة المتاحة ذات العلامات بالنقر فوق "الدليل الموسوم"

        ميزة مثال
        موقع نشطسر
        موقع ملزمالهيم
        موقع الانقسامحج
        عبر الارتباطالسيستئين
        روابط ثاني كبريتيدالكل
        موقع معدلمنع*
        اختصاصتسلسل الإشارة
        المنتجديرمورفين
        منطقةربط ATP


        iProLINK Feature Mapping Result Page لموقع ربط heme

        ال RLIMS-P عبارة عن برنامج تعدين نصي قائم على القواعد مصمم خصيصًا لاستخراج معلومات فسفرة البروتين على بروتين كيناز والركيزة ومواقع الفسفرة من الملخصات (Hu وآخرون، 2005). يؤدي تقديم PMIDs كمدخلات إلى إرجاع جدول ملخص لجميع PMIDs مع ارتباطات إلى التقارير الكاملة. يسرد جدول الملخص PMID لكل ملخص متعلق بالفسفرة جنبًا إلى جنب مع نتيجة التعليق التوضيحي الأعلى مرتبة ، متبوعًا بقائمة من PMIDs المتبقية للملخصات التي لا تحتوي على معلومات الفسفرة. يمكن استرجاع التقارير الكاملة من جدول الملخص باستخدام روابط النص التشعبي (من "دليل نصي") أو عن طريق اختيار واحد أو أكثر من PMID (s) في القائمة.

        جدول ملخص لـ PMIDs 2108025 ، 16436437 ، 15193450

        يحتوي تقرير RLIMS-P الكامل على خمسة أقسام (انظر الجدول أدناه): 1- معلومات الاقتباس في PubMed (تاريخ النشر ، المؤلفون ، المجلة) 2- رسم خرائط PMID إلى UniProtKB ، ويتألف من الإدخال ، والمعرف ، واسم البروتين ، والكائن الحي ، وعائلة البروتين للإدخال المعين ، مع روابط إلى UniProtKB و iProClass (Wu et al. ، 2004) تقارير البروتين التي تحتوي على معلومات بيولوجية ووظيفية غنية 3- تعيين الاسم إلى UniProtKB ، بما في ذلك خيارات استخدام إما الأسماء الواردة في الملخص أو الأسماء المحددة من قبل المستخدم للبحث على الإنترنت في BioThesaurus 4- شرح بقائمة مرتبة لنتائج استخراج RLIMS-P لكل مجموعة من كائنات الفسفرة الثلاثة و 5- دليل نصي يُظهر الملخص الأصلي والعنوان ، مع تمييز الأشياء المستخرجة بألوان مختلفة لتمييز كينازات البروتين والبروتينات الفسفورية والبقايا / المواضع الفسفورية. يتوفر خيار لتشغيل / إيقاف تشغيل علامات اللون لكل نوع من الكائنات في الملخص للفحص البصري.

        التقرير الكامل عن PMID 2108025

        التعرف على الكيانات / تطوير علم الوجود
        يعد التعرف على الكيانات المسماة بالبروتين (العثور على أسماء البروتين من نصوص الأدبيات) شرطًا أساسيًا لرسم خرائط ببليوغرافيا (تحديد الأوراق التي تصف البروتينات المحددة). كما أنه أساسي للعديد من مهام التنقيب في الأدبيات البيولوجية الأخرى ، بما في ذلك استخراج شروح البروتين (مثل تفاعلات البروتين والبروتين) من الأدبيات.

        -بيو ثيسوروس
        BioThesaurus هو نظام قائم على الويب مصمم لتعيين مجموعة شاملة من أسماء البروتين والجينات لمدخلات بروتين UniProtKB. يغطي BioThesaurus حاليًا أكثر من مليوني بروتين ، ويتألف من أكثر من 2.6 مليون اسم مستخرج من موارد متعددة عبر الإنترنت استنادًا إلى المراجع التبادلية لقاعدة البيانات في iProClass. يسمح باسترجاع الأسماء المترادفة لإدخالات بروتين معينة وتحديد الأسماء الغامضة التي تشترك فيها عدة بروتينات.
        يمكنك البحث عن طريق كتابة اسم الجين / البروتين ، أو بدلاً من ذلك ، باستخدام المعرف.

        تقرير BioThesaurus عن UniProtKB P18688

        • المصطلحات الطبية الحيوية (bt): تستخدم هذه المصطلحات في مجموعة واسعة من العلوم البيولوجية والطبية. يصفون بشكل أساسي هياكل جميع أشكال الحياة على مستويات مختلفة (من التشكل الإجمالي إلى التركيب الجزيئي) ، بالإضافة إلى وظائف وآليات كل منهم في كل من الحالات الطبيعية (الفسيولوجية) والمرضية (المرضية).
        • المصطلحات الكيميائية (ct): هذه هي الكلمات التي تصف المواد الكيميائية العضوية أو غير العضوية ، أو المجموعات أو الروابط الكيميائية ، أو الخصائص الكيميائية.
        • الجزيئات الكبيرة (mc): تشير هذه الكلمات إلى البوليمرات الحيوية مثل البروتينات أو الببتيدات أو الحمض النووي أو الحمض النووي الريبي أو السكريات أو البروتينات السكرية.
        • اللغة الإنجليزية الشائعة (م): تستخدم الكلمات الإنجليزية الشائعة لوصف جوانب أو خصائص مختلفة من البروتينات ، مثل قصيرة إشارة متفاعلة و يصلح. وتشمل هذه أيضًا أشكالًا مكتوبة من الأحرف اليونانية ، بالإضافة إلى كلمات التوقف مثل من في، و إلى.
        • الرموز المميزة بخلاف الكلمات: هي مجموعات من الأحرف أو الأرقام أو الرموز. غالبًا ما تكون اختصارات أو مرادفات أو اختصارات. يمكن أن يكون شكل الرموز المميزة غير المكونة من كلمات أرقامًا فقط أو حرفًا واحدًا أو أحرفًا متعددة أو مجموعات من الأرقام والحروف والرموز الأخرى. قد ترمز الرموز التي لا تحتوي على كلمات إلى كيانات كيميائية حيوية مثل الأحماض النووية والنيوكليوتيدات والأحماض الأمينية ، والتي يمكن استخدامها في اسم البروتين.

        -إرشادات توصيف اسم البروتين و Corpora الاسم الذي تم وضع علامة عليه
        موارد بيانات iProLINK الأخرى للتعرف على الكيانات المسماة مجموعتان من مجموعات الأدبيات التي تم تمييزها يدويًا بأسماء البروتين بناءً على نسختين من إرشادات وضع العلامات. يحدد المبدأ التوجيهي 1.0 كيفية تمييز كائنات البروتين ، وليس الكيانات المسماة بالبروتين ، بينما يحدد المبدأ التوجيهي 2.0 قواعد وضع العلامات للكيانات المسماة بالبروتين بغض النظر عن سياق الكائن.

        -PIRSF علم الوجود البروتين القائم على تصنيف الأسرة
        تعتبر الأنطولوجيا البيولوجية ضرورية لإدارة المعرفة البيولوجية ، بما في ذلك بيانات أدبيات التعدين لاستخراج المعلومات ذات الصلة ودمج المعلومات من قواعد بيانات متعددة. يمكن استخدام علم الوجود البروتيني - الذي يتكون من أسماء ومرادفات لفئات البروتين بالإضافة إلى علاقاتها - للمساعدة في التعرف على كيان البروتين المسمى. علاوة على ذلك ، يمكن تعيين علم الوجود المستند إلى العلاقات الأسرية للبروتين ، مثل نظام تصنيف PIRSF ، إلى علم الوجود الجيني (GO) واستكماله. لقد قمنا بتطوير علم الوجود البروتيني بناءً على أسماء عائلة PIRSF الهرمية. الأنطولوجيا في تنسيق ملف GO مسطح بهيكل DAG (رسم بياني دوري موجه) ، ويمكن تصفحها باستخدام أدوات التطبيق مثل DAG-Edit.

        تعليمات البحث النصي

        حدد قاعدة بيانات
        اعتمادًا على المسار الذي تم من خلاله الوصول إلى صفحة بحث النص ، قد تحتاج إلى الاختيار بين قاعدة بيانات iProClass ، والتي تتضمن UniProtKB وبروتينات UniParc الفريدة ، وقاعدة بيانات PIRSF ، والتي تتضمن المجموعة الكاملة من عائلات PIRSF (أي ، أي مستوى تنظيم) . ومع ذلك ، يستخدم البحث عن النص في الصفحة الرئيسية ومربع البحث السريع قاعدة بيانات iProClass.
        سيعرض ملف الإخراج جدولاً بإدخالات بروتين فردية أو عائلات بروتينية لـ iProClass أو PIRSF ، على التوالي.

        اختيار المجال
        يتم تحديد الحقول القابلة للبحث من القائمة المنسدلة. ستختلف العناصر وفقًا لقاعدة البيانات المحددة ، نظرًا لأن كل قاعدة بيانات تحتوي على أنواع مختلفة من المعلومات.

        إدخال الاستعلام
        أدخل معرّفًا فريدًا أو سلسلة بحث أخرى في المربع المتوفر.
        ستكون بعض العناصر (مثل "الطول" أو أي شيء يحمل "المعرّف") عبارة عن عمليات بحث مطابقة تمامًا. ستكون العناصر الأخرى عبارة عن عمليات بحث فرعية (كما لو كانت مسبوقة ومتبوعة بأحرف شاملة).
        عندما يكون خيار الحقل موجودًا ، سيؤدي إدخال "ليس فارغًا" في مربع النص إلى إرجاع البحث فقط تلك الإدخالات التي تحتوي على بعض البيانات في الحقل المحدد ، بينما يؤدي إدخال "فارغ" إلى إرجاع تلك التي تفتقر إلى البيانات في الحقل المحدد فقط .
        للبحث عن الببتيد ، اكتب سلسلة من بقايا الأحماض الأمينية في رمز حرف واحد (ثلاثة أحرف على الأقل) ، ثم اضغط على السهم لاسترداد النتائج.

        إضافة زر مربع الإدخال
        إذا رغبت في ذلك ، يمكن البحث في عدة حقول في وقت واحد. يؤدي الضغط على الزر "+ مربع" إلى إضافة سطر استعلام آخر بحد أقصى 8 أسطر. مربعات الإدخال المضافة متصلة بخيارات المشغل المنطقية (انظر أدناه) ، مع الوضع الافتراضي هو إضافة عامل.

        استخدام العوامل المنطقية AND، OR، NOT
        يدعم البحث عوامل التشغيل المنطقية "AND" و "OR" و "NOT". على سبيل المثال ، لاسترداد النتائج التي تتضمن مجالات Pfam A أو B ، اكتب A في حقل الاستعلام الأول وأضف سطر استعلام بالنقر فوق الزر "إضافة مربع الإدخال". أدخل استعلامك الثاني (B) وحدد عامل التشغيل OR. وبالمثل ، لاسترداد البروتينات متعددة المجالات التي تحتوي على مجالات Pfam A و B ، استخدم عامل التشغيل "AND". يمكن استرداد البروتينات التي لها المجال A وليس المجال B باستخدام عامل التشغيل "NOT".

        عدد النتائج
        لتقديم أسرع نتيجة ، يكون العدد الافتراضي للإدخالات المعروضة في أي صفحة هو 50.

        تصنيفات البحث والمعرفات الفريدة
        يوضح الجدول التالي الحقول القابلة للبحث لوظائف بحث النص واسترجاع الدُفعات. يمكن تحديد الحقول القابلة للبحث من القائمة المنسدلة. يمكنك البحث في قواعد البيانات باستخدام معرفات فريدة أو كلمات رئيسية. يتم عرض أمثلة الإدخال أدناه.

        الفئة الرئيسية تصنيف فرعي الحقول المضمنة أمثلة) أنا ProClass بيرسف
        تسلسلمعرفات UniProtمعرف UniProtKB / ACIMDH2_HUMAN / P12268
        UniRef100UniRef100_P12268
        UniParcUPI00004C7276
        معرفات تسلسل PIRمعرف PIR-PSD / ACA31997 / I52303
        معرفات التسلسل الأخرى
        معرف FlyBaseFBgn0002940
        GenBank ACJ04208
        GenPept ACAAH12840.1
        رقم NCBI GI15277480
        معرف IPIIPI00291510
        معرف MGI95561
        المرجع ACNM_000875
        معرف SGDS000001047
        معرف TIGRSAG1156
        اسم الجين / البروتيناسم الجينIMPDH2
        اسم البروتيننازعة هيدروجين IMP
        تصنيفمعرفات الفئة
        معرف الكتلIPB000644
        معرف COGCOG1009
        معرف Pfam / الاسمPF00478
        نازعة هيدروجين IMP
        معرف / اسم PIRSFPIRSF000130
        إنوزين-5'- أحادي الفوسفات ديهيدروجينيز
        معرف الطباعةPR01434
        معرف PROSITEPS00487
        اسم العائلة الفائقة SCOPنازعة هيدروجين أحادي الفوسفات إينوزين
        معرف UniRef50UniRef50_P20839
        معرف UniRef90UniRef90_P12268
        بيرسفمتوسط ​​الطول500 (أحماض أمينية)
        حالة التنظيمممتلىء
        عضوية PIRSFPIRSF000186: ف
        مستوى PIRSFHFam
        ممثل Seq.P12268
        وظيفةمعقدة / تفاعلاتمعرف BIND93185
        هذا هو المواد التي سوف تستخدمGO ID0003938
        مسار مسار / معرف KEGGاستقلاب البيورين
        hsa00230
        إنزيمرقم / اسم المفوضية الأوروبيةEC 1.1.1.205/ Oxidoreductases
        ميزةمعرف الإقامةAA0005
        جميع الحقول المميزةL- سيستين
        الكائن الحيالتصنيفتايسون
        معرف المجموعة / المجموعة
        يوك / ثدي / 40674
        معرف التصنيف9606
        الأنواع / النسبالنسبحقيقيات النوى
        اسم الكائن الحيالانسان العاقل
        اسم شائعبشر
        المؤلفاتمعرف PubMedمعرف PubMed10097070
        اسم المؤلفاسم المؤلفهوبرمان
        اسم المجلةاسم المجلةBiochem Biophys Res Commun.
        عنوان الورقةعنوان الورقةاستنساخ وتسلسل الإنسان من النوع الثاني IMP
        متنوع هيكل ثلاثي الأبعادمعرف PDB1B3O
        ملكيةطول514 (أحماض أمينية)
        الوزن الجزيئي الغرامي55804 (دالتونس)
        الكلمة الرئيسيةالكلمة الرئيسيةNAD
        الاختلاف الجيني / المرضمعرف OMIM146691
        الجينوم معرف جين انتريز3615

        تعليمات نتيجة البحث عن النص

        يصف هذا القسم صفحة نتائج البحث عن نص لـ iProClass و PIRSF. يتشابه التخطيط العام للصفحة لكليهما ، ومع ذلك ، فإنه يختلف في الأعمدة الافتراضية التي يتم عرضها ، بالإضافة إلى الأدوات المتاحة لتحليل البيانات. يتم وصف الميزات المشتركة أولاً 1-3، حيث تشير الأرقام إلى المكان الذي ستجد فيه هذه الميزات في الصفحة (انظر صفحات نتائج iProClass و PIRSF أدناه).

        2- خيارات العرض
        بناءً على حاجتك المحددة ، يمكنك اختيار الأعمدة المراد عرضها. للقيام بذلك ، انقر فوق الزر "خيار العرض" ، وحدد الحقل (الحقول) ذات الصلة في قائمة "الحقول غير المعروضة" وانقلها إلى قائمة "الحقول في العرض" عبر " & GT ". وعلى العكس من ذلك ، يمكن إزالة الأعمدة من العرض. وأخيرًا ، انقر فوق" تطبيق "لتصبح التغييرات سارية المفعول.

        3- حفظ النتائج باسم
        يمكن حفظ الإخراج على الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        5- عرض النتائج
        يتم عرض نتائج البحث في جدول قابل للتخصيص. ستعتمد الأعمدة الدقيقة المعروضة على الحقول التي يتم البحث عنها وتفضيلات المستخدم.

        AC / ID البروتين
        يشير معرف البروتين / معرف البروتين إلى معرفات UniProtKB أو UniParc. أسفل هذه الأرقام ، يمكنك اختيار إما عرض iProClass أو عرض UniProtKB / UniParc لتقرير البروتين. يظهر مصدر تسلسل UniProtKB كـ UniProtKB / Swiss-Prot أو UniProtKB / TrEMBL إذا كان تسلسل البروتين من قسم Swiss-Prot أو TrEMBL ، على التوالي. بدلاً من ذلك ، سيتم عرض معرف UniParc إذا لم يكن التسلسل موجودًا في قاعدة بيانات UniProtKB جنبًا إلى جنب مع تقرير UniParc.

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        معرف PIRSF
        إذا كان البروتين ينتمي إلى عائلة PIRSF ، فسيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF (انظر الإخراج المشروح).

        التسلسل ذات الصلة.
        يوضح هذا العمود عدد مرات الوصول إلى BLAST المحسوبة مسبقًا والتي تم الحصول عليها باستخدام المعلمات الافتراضية. سيتم عرض ما يصل إلى 300 تسلسل فقط. بالنقر على الرقم يمكنك الوصول إلى صفحة التسلسل ذات الصلة. يتيح ذلك إلقاء نظرة سريعة على تشابه التسلسل بطريقة سريعة جدًا. يوفر الرقم نفسه بالفعل بعض المعلومات حول مدى تميز البروتين. على سبيل المثال ، قد يخبرك رقم منخفض جدًا أن الاستعلام خاص بنوع معين ، أو جنس ، أو أصنف ، وما إلى ذلك. تسمح علامة "+" بجوار عنوان التسلسل المرتبط بمقارنة عدد التسلسلات ذات الصلة بثلاثة قيم E مختلفة القطع كما هو مبين أدناه.

        الحقول المتطابقة
        الحقول المطابقة بواسطة الاستعلام.

        6- GO Slim
        GO Slims هي إصدارات أصغر من Gene Ontology تحتوي على مجموعة فرعية من المصطلحات في GO بأكملها. يقدمون نظرة عامة واسعة على محتوى الأنطولوجيا بدون تفاصيل المصطلحات الدقيقة المحددة. تعتبر GO Slims مفيدة بشكل خاص لإعطاء ملخص لنتائج شرح GO للجينوم أو البروتين عندما يكون التصنيف الواسع لوظيفة المنتج الجيني مطلوبًا.

        يمكنك عرض مصطلحات GO Slim للوظيفة البيولوجية والمكون والعملية عن طريق تحديد الزر "إظهار GO Slim" في شريط أدوات التحليل أ. يمكنك بعد ذلك عرض إحصائيات الأنطولوجيا الفردية (الوظيفة والمكون والوظيفة) عن طريق التحقق من إدخالات الاهتمام واختيار الأنطولوجيا المراد عرضها (على سبيل المثال ، الوظيفة في هذا المثال ، أ). اتبع روابط GO ID لمعرفة المزيد عن مصطلح GO. بالإضافة إلى ذلك ، يمكنك عرض المصطلحات داخل الأنطولوجيا عن طريق تحديد أيقونة العرض الهرمي الرسومية GO (ب). سيعرض العرض الرسومي تسلسل GO الهرمي فيما يتعلق بالمصطلحات الموضحة في الجدول ج). تظهر المصطلحات التي ترتبط ببروتين معين بالألوان ، ويشير الرقم الموجود بين قوسين إلى عدد البروتينات في المجموعة المحددة التي تم شرحها بالمصطلح المحدد. سيؤدي النقر فوق الرقم إلى استرداد مدخلات البروتين المقابلة. يتوفر خيار لعرض الرسم البياني بتنسيق svg. يسمح هذا التنسيق بإعادة قياس الصورة.

        إذا تم تحديد أكثر من PIRSF ، فستشير رسالة منبثقة إلى أنه سيتم استخدام التسلسلات التمثيلية لكل عائلة للمحاذاة.

        5- عرض النتائج
        يتم عرض نتائج البحث في جدول قابل للتخصيص. ستعتمد الأعمدة الدقيقة المعروضة على الحقول التي يتم البحث عنها وتفضيلات المستخدم.

        معرف PIRSF
        سيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF. تشير الأيقونة الموجودة أسفل معرف PIRSF إلى مستوى الأسرة ، أي الأسرة المتجانسة (H Fam) ، والعائلة الفرعية (Sub Fam) ، والعائلة الفائقة (Super Fam). سيؤدي النقر فوق هذا الرمز إلى إحضار عرض DAG لتسلسل PIRSF الهرمي مع مجال PFam في المستوى الأعلى.

        اسم PIRSF
        اسم PIRSF ذو مغزى للعائلات المنسقة بالكامل حيث تم تحليل هذه الأسماء من قبل أمين المعرض. يهدف اسم PIRSF إلى وصف بعض الخصائص أو الوظائف المشتركة لأفراد الأسرة. كلما أمكن ، تستند أسماء PIRSF إلى الأدبيات وتحاول اتباع أي معايير منشورة. في معظم الحالات ، يكون للأسماء علامة إثبات أو حالة اسم مرفقة بين قوسين ، مما يوفر مستوى الثقة في الاسم المخصص. علامات حالة اسم PIRSF المحتملة هي: تم التحقق من صحتها (هناك بيانات تجريبية تدعم اسم PIRSF) ، مؤقتة (لا يوجد دليل تجريبي قاطع) أو متنبأ بها (تم التنبؤ بها بواسطة الطرق الحسابية).

        رقم. من التسلسل.
        عدد المتتاليات في الأسرة.

        Av.Length
        هو متوسط ​​طول البروتين لأعضاء PIRSF.

        هندسة المجال
        إنه يمثل المعلومات المنسقة فيما يتعلق بمجالات Pfam الحالية في عائلة البروتين. يتم سرد مجالات Pfam بالترتيب من N- إلى C- نهاية مفصولة بفواصل منقوطة. في حالات قليلة ، يتم فصل المجالات بشرطة تشير إلى وجود المجالات المدرجة. تشير الأرقام الموجودة بين قوسين إلى تكرار المجال. هناك بناء جملة خاص لهذه الميزة. على سبيل المثال ، يسمح PF11111 (1-3) بنسخ من 1 إلى 3 نسخ من PF11111 ، بينما يسمح PF11111 (2-) بأي عدد من المجالات أعلى من 1 (2 أو أكثر). ومع ذلك ، لا يسمح PF11111 (0،2) بنسخ أو نسختين من هذا المجال.

        حالة التنظيم
        غير مشبع: مجموعات بروتينية مولدة بالحاسوب ، غير منسقة.
        تمهيدي: عضوية وبنية المجال لعائلات البروتين التي تحددها المعالجة اليدوية.
        كامل: اسم عائلة البروتين مع المراجع المصاحبة (عند توفرها) ، وأوصاف موجزة في بعض الأحيان ، يتم تقديمها بعد المعالجة اليدوية الشاملة.

        الحقول المتطابقة
        الحقول المطابقة بواسطة الاستعلام.

        تعليمات استرداد الدُفعات

        استرجع عدة إدخالات عن طريق تحديد معرف معين أو مجموعة من المعرفات.

        حدد قاعدة البيانات
        قبل إدخال معرفات البروتين ، تحتاج إلى تحديد قاعدة البيانات الأكثر ملاءمة. إذا كنت ترغب في استرداد معلومات حول عائلات البروتين ، فحدد قاعدة بيانات PIRSF ، ولكن إذا كنت مهتمًا بتحليل البروتينات الفردية ، فحدد قاعدة بيانات iProClass.

        قواعد إدخال المعرفات
        يجب فصل معرفات الإدخال المتعددة بخطوط أو مسافات.
        يمكن تحديد المعرفات كفئة واحدة أو فئات مختلطة. ومع ذلك ، إذا كانت إدخالاتك لها نفس نوع المعرف ، فمن المستحسن أن تحدد حقل المعرف لتسريع عملية الاسترجاع.


        يمكنك تحليل وحفظ أي نتائج مسترجعة و / أو تسلسلها بطريقة مماثلة كما تفعل بعد البحث النصي. انقر فوق "إظهار قائمة المطابقة" للتحقق من المراسلات بين معرفات الإدخال الخاصة بك وتلك الموجودة في قاعدة البيانات المحددة.

        إخراج استرداد الدُفعات في قاعدة بيانات iProClass

        استرجاع التسلسلات بأرقام GI 1169968 و 1707983 و 304131

        1- صندوق الاسترجاع
        يعرض هذا المربع معرف الاستعلام الخاص بك ويسمح لك أيضًا بإجراء استرداد جديد.

        2- خيارات العرض
        بناءً على حاجتك المحددة ، يمكنك اختيار الأعمدة المراد عرضها. للقيام بذلك ، انقر فوق الزر "خيار العرض" ، وحدد الحقل (الحقول) ذات الصلة في قائمة "الحقول غير المعروضة" وانقلها إلى قائمة "الحقول في العرض" عبر " & GT ". وعلى العكس من ذلك ، يمكن إزالة الأعمدة من العرض. وأخيرًا ، انقر فوق" تطبيق "لتصبح التغييرات سارية المفعول.

        3- حفظ النتائج باسم
        يمكن حفظ الإخراج على الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        5- عرض النتائج
        يتم عرض نتائج البحث في جدول.

        AC / ID البروتين
        يشير معرف / معرف البروتين إلى رقم تعريف ومعرف UniProtKB على التوالي. أدناه ، يمكنك اختيار إما عرض iProClass أو عرض UniProtKB / UniParc لكل تقرير بروتين.يظهر مصدر تسلسل UniProtKB كـ UniProtKB / SP أو UniProtKB / Tr إذا كان تسلسل البروتين من Swiss-Prot أو TrEMBL ، على التوالي.

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        معرف PIRSF
        إذا كان البروتين ينتمي إلى عائلة PIRSF ، فسيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF.

        نطاق المباراة
        يعرض هذا العمود باللون الأحمر الاستعلام الببتيد داخل التسلسل.

        6- GO Slim
        GO Slims هي إصدارات أصغر من Gene Ontology تحتوي على مجموعة فرعية من المصطلحات في GO بأكملها. يقدمون نظرة عامة واسعة على محتوى الأنطولوجيا بدون تفاصيل المصطلحات الدقيقة المحددة. تعتبر GO Slims مفيدة بشكل خاص لإعطاء ملخص لنتائج شرح GO للجينوم أو البروتين عندما يكون التصنيف الواسع لوظيفة المنتج الجيني مطلوبًا.

        يمكنك عرض مصطلحات GO Slim للوظيفة البيولوجية والمكون والعملية عن طريق تحديد الزر "إظهار GO Slim" في شريط أدوات التحليل. يمكنك بعد ذلك عرض إحصائيات الأنطولوجيا الفردية (الوظيفة والمكون والوظيفة) عن طريق التحقق من إدخالات الاهتمام واختيار الأنطولوجيا المراد عرضها (على سبيل المثال ، الوظيفة في هذا المثال). اتبع روابط GO ID لمعرفة المزيد عن مصطلح GO.

        7- إظهار قائمة المباريات
        يعرض جدولاً يعين معرفات الاستعلام الخاصة بك مع معرفات UniProtKB / UniParc.

        إخراج استرجاع الدُفعات في قاعدة بيانات PIRSF

        استرجاع PIRSFs باستخدام استعلامات UniProtKB ACs P51375 و P09831 و Q05755

        1- صندوق الاسترجاع
        يعرض هذا المربع معرف الاستعلام الخاص بك ويسمح لك أيضًا بإجراء استرداد جديد

        2- خيارات العرض
        بناءً على حاجتك المحددة ، يمكنك اختيار الأعمدة المراد عرضها. للقيام بذلك ، انقر فوق الزر "خيار العرض" ، وحدد الحقل (الحقول) ذات الصلة في قائمة "الحقول غير المعروضة" وانقلها إلى قائمة "الحقول في العرض" عبر " & GT ". وعلى العكس من ذلك ، يمكن إزالة الأعمدة من العرض. وأخيرًا ، انقر فوق" تطبيق "لتصبح التغييرات سارية المفعول.

        3- حفظ النتائج باسم
        يمكن حفظ الإخراج على الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        5- عرض النتائج
        يتم عرض نتائج البحث في جدول.

        معرف PIRSF
        سيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF. تشير الأيقونة الموجودة أسفل معرف PIRSF إلى مستوى الأسرة ، أي الأسرة المتجانسة (H Fam) ، والعائلة الفرعية (Sub Fam) ، والعائلة الفائقة (Super Fam). سيؤدي النقر فوق هذا الرمز إلى إحضار عرض DAG لتسلسل PIRSF الهرمي مع مجال PFam في المستوى الأعلى.

        اسم PIRSF
        الاسم المعطى للعائلة الذي يحدد وظيفتها أو يحدد ميزاتها. اعتمادًا على حالة التنظيم ، يتم تعيين هذا الاسم تلقائيًا (بدون تنظيم يدوي) أو يدويًا (تنظيم كامل). إذا كانت العائلة منسقة ، فقد تعرض علامة بجوار الاسم تشير إلى حالتها ، أي تم التحقق من صحتها (هناك بيانات تجريبية تدعم اسم PIRSF) ، أو مؤقتة (لا يوجد دليل قاطع) أو متوقعة (تم التنبؤ بها بواسطة الطرق الحسابية).

        طول
        هو متوسط ​​طول البروتين لأعضاء PIRSF.

        هندسة المجال
        إنه يمثل المعلومات المنسقة فيما يتعلق بمجالات Pfam الحالية في عائلة البروتين. يتم سرد مجالات Pfam بالترتيب من N- إلى C- نهاية مفصولة بفواصل منقوطة. في حالات قليلة ، يتم فصل المجالات بشرطة تشير إلى وجود المجالات المدرجة. تشير الأرقام الموجودة بين قوسين إلى تكرار المجال. هناك بناء جملة خاص لهذه الميزة. على سبيل المثال ، يسمح PF11111 (1-3) بنسخ من 1 إلى 3 نسخ من PF11111 ، بينما يسمح PF11111 (2-) بأي عدد من المجالات أعلى من 1 (2 أو أكثر). ومع ذلك ، لا يسمح PF11111 (0،2) بنسخ أو نسختين من هذا المجال.

        حالة التنظيم
        غير مشبع: مجموعات بروتينية مولدة بالحاسوب ، غير منسقة.
        تمهيدي: عضوية وبنية المجال لعائلات البروتين التي تحددها المعالجة اليدوية.
        كامل: اسم عائلة البروتين مع المراجع المصاحبة (عند توفرها) ، وأوصاف موجزة في بعض الأحيان ، يتم تقديمها بعد المعالجة اليدوية الشاملة.

        الحقول المتطابقة
        الحقول المطابقة بواسطة الاستعلام.

        6- إظهار قائمة المطابقة
        يعرض جدولاً يعين معرفات الاستعلام الخاصة بك إلى PIRSF المقابل.

        مساعدة بحث بلاست

        .
        2. تنسيق البحث المتفجر
        تقبل منطقة إدخال "بحث" بلاست:

        خيارات الانفجار
        يتم تنفيذ BLAST باستخدام مصفوفة BLOSUM62 بقيم افتراضية لفتح الفجوة وتكلفة التمديد. ومع ذلك ، يمكن تعيين المعلمات التالية:

        -الإحصائيات القائمة على التكوين
        يسمح بلاست بالقيم الإلكترونية المحسوبة لمراعاة تكوين الأحماض الأمينية لتسلسلات قاعدة البيانات الفردية المشاركة في المحاذاة المبلغ عنها. يؤدي ذلك إلى تحسين دقة القيمة الإلكترونية ، وبالتالي تقليل عدد النتائج الإيجابية الخاطئة. يتم تحقيق الإحصائيات المحسّنة من خلال إجراء القياس الذي يستخدم في الواقع نظام تسجيل مختلف قليلاً لكل تسلسل قاعدة بيانات. نتيجة لذلك ، فإن درجات محاذاة BLAST الخام بشكل عام لن تتوافق بدقة مع تلك التي تتضمنها أي مصفوفة استبدال قياسية. علاوة على ذلك ، يمكن أن تتلقى المحاذاة المتطابقة درجات مختلفة ، بناءً على تركيبات التسلسلات التي تنطوي عليها.

          منخفضة التعقيد
          يقنع أجزاء تسلسل الاستعلام ذات التعقيد التركيبي المنخفض ، كما هو محدد بواسطة برنامج SEG لـ Wootton & Federhen (الكمبيوتر والكيمياء ، 1993). يمكن أن تقضي التصفية على التقارير المهمة إحصائيًا ولكنها غير مهمة بيولوجيًا من ناتج BLAST (على سبيل المثال ، الزيارات ضد المناطق الشائعة الحمضية أو الأساسية أو الغنية بالبرولين) ، مما يترك المناطق الأكثر إثارة للاهتمام بيولوجيًا في تسلسل الاستعلام متاحًا لمطابقة محددة مقابل تسلسل قاعدة البيانات. يتم تطبيق التصفية فقط على تسلسل الاستعلام ، وليس على تسلسلات قاعدة البيانات.
          قناع لجدول البحث فقط
          يقنع هذا الخيار فقط لأغراض إنشاء جدول البحث المستخدم بواسطة BLAST. تتكون عمليات بحث بلاست من مرحلتين ، حيث يتم العثور على النتائج بناءً على جدول البحث ثم توسيعها. يقوم خيار "إخفاء جدول البحث فقط" بأقنعة لجدول البحث فقط بحيث لا يتم العثور على أي نتائج بناءً على تسلسل منخفض التعقيد. يتم تنفيذ امتدادات BLAST بدون إخفاء وبالتالي يمكن تمديدها من خلال تسلسل منخفض التعقيد. لا يزال هذا الخيار تجريبيًا وقد يتغير في المستقبل القريب.
          قناع صغير
          مع تحديد هذا الخيار ، يمكنك قص ولصق تسلسل FASTA بأحرف كبيرة والإشارة إلى المناطق التي تريد تصفيتها بأحرف صغيرة. يتيح لك ذلك تخصيص ما يتم تصفيته من التسلسل أثناء المقارنة بقواعد بيانات بلاست.

        -يتوقع
        تحدد عتبة توقع عتبة دلالة إحصائية لمطابقات تسلسل قاعدة البيانات للإبلاغ. القيمة الافتراضية هي 10 ، مما يعني أنه من المتوقع العثور على 10 مطابقات بالصدفة فقط. تعد حدود التوقعات المنخفضة أكثر صرامة ، مما يؤدي إلى تقليل حالات تطابق الفرص التي يتم الإبلاغ عنها. تُظهر زيادة الحد الأقصى المتوقع تطابقات أقل صرامة ويوصى به عند إجراء عمليات بحث بتسلسلات قصيرة حيث من المرجح أن يحدث الاستعلام القصير عن طريق الصدفة في قاعدة البيانات أكثر من الاستفسار الأطول ، لذلك حتى المطابقة الكاملة (بدون فجوات) يمكن أن يكون لها أهمية إحصائية منخفضة وقد لا يتم الإبلاغ عنها. تتيح لك زيادة عتبة توقع النظر إلى أسفل في قائمة النتائج ومشاهدة التطابقات التي يتم تجاهلها عادةً بسبب الأهمية الإحصائية المنخفضة.

        -حجم الكلمة
        يشير حجم الكلمة إلى طول التسلسل الأولي الذي يجب مطابقته بين قاعدة البيانات وتسلسل الاستعلام.

        -مصفوفة
        عنصر أساسي في تقييم جودة محاذاة التسلسل الزوجي هو "مصفوفة الاستبدال" ، والتي تحدد درجة لمحاذاة أي زوج محتمل من المخلفات. يمكن تغيير المصفوفة المستخدمة في بحث BLAST اعتمادًا على نوع التسلسلات التي تبحث عنها. يمكن للمستخدم الاختيار من قائمة المصفوفات التي تغطي قيودًا تطورية مختلفة (يمكن العثور على مزيد من المعلومات في وصف مصفوفات تسجيل بلاست). لكل مصفوفة ، يتم عرض تكلفة الفجوة الافتراضية المعتمدة على المصفوفة. يتم وصف تكاليف الفجوة أدناه.

        -تكلفة الفجوة المعتمدة على المصفوفة
        تعرض القائمة المنسدلة تكاليف الفجوة (عقوبة لفتح فجوة وعقوبة لتوسيع الفجوة). هناك عدد محدود من الخيارات لهذه المعلمات. ستؤدي زيادة تكاليف الفجوة إلى محاذاة تقلل من عدد الفجوات المقدمة. فجوة الجزاء المفتوحة هي النتيجة التي يتم أخذها من أجل بدء فجوة في التسلسل. لجعل المباراة أكثر أهمية ، يمكن للمستخدم محاولة جعل عقوبة الفجوة أكبر. تتم إضافة عقوبة تمديد الفجوة إلى فجوة عقوبة الفتح لكل بقايا في الفجوة ، مما يؤدي إلى معاقبة الفجوات الأطول بشكل فعال. إذا كان المستخدم لا يحب الفجوات الطويلة ، فيمكنه زيادة عقوبة فجوة الامتداد. عادة ما يتوقع المرء بضع فجوات طويلة بدلاً من العديد من الفجوات القصيرة ، لذلك يجب أن تكون عقوبة تمديد الفجوة أقل من عقوبة الفجوة. الاستثناء هو عندما يكون أحد التسلسلين أو كليهما عبارة عن قراءة فردية مع وجود أخطاء تسلسلية محتملة ، وفي هذه الحالة قد تتوقع العديد من الفجوات الأساسية الفردية. يمكن للمستخدم الحصول على هذه النتيجة عن طريق ضبط فجوة عقوبة الفتح على صفر (أو منخفضة جدًا) واستخدام عقوبة تمديد الفجوة للتحكم في تسجيل الفجوة.

        -ضبط تكاليف الفجوة
        غالبًا ما يتم تحسين المحاذاة بين التسلسلات من خلال السماح بالفجوات داخل أحد التسلسل أو كليهما. مثل عدم التطابق بين المخلفات المتوافقة ، فإن الفجوات لها "تكلفة" مرتبطة بها. هناك عقوبات منفصلة لفتح وتوسيع الفجوات. ستؤدي زيادة تكاليف الفجوة إلى محاذاة تقلل من عدد وحجم الفجوات المقدمة. تكلفة الفجوة المفتوحة (أو تكلفة وجود الفجوة) هي الدرجة التي يتم الحصول عليها لبدء فجوة في تسلسل. لجعل المباراة أكثر أهمية ، يمكن للمستخدم محاولة جعل عقوبة الفجوة أكبر. تتم إضافة تكلفة Gap Extend إلى تكلفة Gap Open لكل بقايا في الفجوة ، مما يؤدي إلى معاقبة الفجوات الأطول بشكل فعال. لذلك يمكن للمستخدم الاختيار ضد الفجوات الطويلة من خلال زيادة هذه العقوبة. عادة ما يتوقع المرء بضع فجوات طويلة بدلاً من العديد من الفجوات القصيرة ، لذلك يجب أن تكون تكلفة Gap Extend أقل من تكلفة Gap Open. يمكن تعديل "تكاليف الفجوة" بالنسبة إلى القيمة الافتراضية باستخدام القائمة المنسدلة.

        -عدد الزيارات المراد عرضها
        يقيد عدد نتائج BLAST للتسلسلات المطابقة التي سيتم الإبلاغ عنها.

        -انتقام
        يحاذي تسلسل الاستعلام وقاعدة البيانات المطابقة في أزواج. ترتبط المطابقات بـ "|" رمز. تتعارض حالات عدم التطابق مع الفراغ. يتم إدخال الفجوات برمز "-".

          Wootton JC، and Federhen S (1993) إحصاءات التعقيد المحلي في متواليات الأحماض الأمينية وقواعد بيانات التسلسل. الكمبيوتر والكيمياء 17: 149-163.

        نتائج بلاست مساعدة

        يظهر أدناه نموذج لإخراج بحث بلاست مقابل قاعدة بيانات UniProtKB

        1- تشغيل تسلسل الاستعلام
        انقر فوق هذا الزر لعرض تسلسل الاستعلام. على العكس من ذلك ، انقر فوقه مرة أخرى لإخفائه.

        2- حفظ النتائج باسم
        يمكن حفظ نتائج البحث على جهاز الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        فرز الأعمدة
        يمكن فرز الأعمدة حسب القيم المقابلة عن طريق النقر فوق السهم الموجود بجوار عنوان العمود. بشكل افتراضي ، يتم فرز الجدول حسب النتيجة.

        يتم عرض نتائج البحث في جدول يحتوي على الأعمدة الافتراضية التالية:

        AC / ID البروتين
        يشير معرف / معرف البروتين إلى رقم تعريف ومعرف UniProtKB على التوالي. أسفل هذه المعرفات ، يمكنك اختيار إما عرض iProClass أو عرض UniProtKB لتقرير البروتين. يظهر مصدر تسلسل UniProtKB كـ UniProtKB / Swiss-Prot أو UniProtKB / TrEMBL إذا كان تسلسل البروتين من قسم Swiss-Prot أو TrEMBL من UniProtKB ، على التوالي.

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        معرف PIRSF
        إذا كان البروتين ينتمي إلى عائلة PIRSF ، فسيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF (انظر الإخراج المشروح).

        أعمدة تشابه تسلسل بلاست
        هناك ثلاثة أعمدة مرتبطة بنتائج بلاست. يُظهر عمود المحاذاة ، في أقصى اليمين ، نتائج BLAST بتنسيق رسومي. يمثل الشريط العلوي تسلسل الاستعلام. توضح الأشرطة أدناه المنطقة (المناطق) في التسلسلات الأخرى المتطابقة مع تسلسل الاستعلام. يشير لون الشريط إلى حجم درجة بلاست. انقر فوق أحد هذه الأشرطة لرؤية محاذاة BLAST مقترنة بتسلسل الاستعلام.

        أعمدة البحث
        SSearch هو تنفيذ مزدوج لخوارزمية محاذاة Smith-Waterman. عند محاذاة تسلسلين ، يتم عرض المنطقة المشتركة فقط. داخل المنطقة المشتركة ، يمكن محاذاة بقايا الأحماض الأمينية من أحد التسلسل أو كليهما إما مع الأحماض الأمينية أو الفجوات من التسلسل الآخر. يتم تمثيل الطول الإجمالي للمنطقة المشتركة ، بما في ذلك الفجوات ، تحت عمود التداخل. يتم إعطاء النسبة المئوية للمخلفات المتطابقة في المحاذاة تحت٪ iden. يؤدي النقر فوق هذا الرقم إلى عرض محاذاة SSearch كاملة الطول.

        5- إظهار الناتج الخام
        يتكون التقرير من ثلاثة أقسام رئيسية: (1) العنوان ، الذي يحتوي على معلومات حول تسلسل الاستعلام ، تم البحث في قاعدة البيانات. (2) الأوصاف المكونة من سطر واحد لكل تسلسل قاعدة بيانات تم العثور عليها لتتطابق مع تسلسل الاستعلام ، وتوفر نظرة عامة سريعة على التصفح (3) المحاذاة لكل تسلسل قاعدة بيانات متطابقة (قد يكون هناك أكثر من محاذاة واحدة لتسلسل قاعدة البيانات التي تتطابق معها) .
        في الأوصاف المكونة من سطر واحد في تقرير بلاست ، يتكون كل سطر من خمسة حقول: (أ) رقم انضمام UniProtKB (ب) معرف UniProtKB ، (ج) اسم البروتين. غالبًا ما يتم اقتطاع هذا الخط في الأوصاف ذات السطر الواحد للحفاظ على ضغط الشاشة (د) درجة المحاذاة بالبتات. تم العثور على نتائج تسجيل أعلى في أعلى القائمة و (هـ) القيمة الإلكترونية ، والتي توفر تقديرًا للأهمية الإحصائية. مقتبس من دليل NCBI.

        يظهر أدناه نموذج لإخراج بحث بلاست مقابل قاعدة بيانات UniRef100

        1- تشغيل تسلسل الاستعلام
        انقر فوق هذا الزر لعرض تسلسل الاستعلام. على العكس من ذلك ، انقر فوقه مرة أخرى لإخفائه.

        2- حفظ النتائج باسم
        يمكن حفظ نتائج البحث على جهاز الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        فرز الأعمدة
        يمكن فرز الأعمدة حسب القيم المقابلة من خلال النقر على السهم الموجود بجوار عنوان العمود. بشكل افتراضي ، يتم فرز الجدول حسب الدرجة.

        يتم احتساب نتائج بلاست للعضو الممثل لكل مجموعة ، قد ترى الأعضاء الآخرين (ولكن لا توجد نتائج BLAST) بالنقر فوق شعار "إظهار كافة الأعضاء". تظهر النتائج في جدول يحتوي على الأعمدة الافتراضية التالية:

        معرف UniRef100
        يشير إلى معرف الكتلة. يوجد أدناه رابط لتقرير UniRef100 بمعلومات عن أعضاء مجموعة UniRef100 ، بالإضافة إلى روابط لمجموعات UniRef50 و UniRef90.

        AC البروتين
        يشير البروتين AC إلى انضمام UniProtKB أو معرف UniParc. أسفل هذه المعرفات ، يمكنك اختيار إما iProClass أو عرض UniParc لتقرير البروتين ، على التوالي.

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        أعمدة تشابه تسلسل بلاست
        هناك ثلاثة أعمدة مرتبطة بنتائج بلاست. يُظهر عمود المحاذاة ، في أقصى اليمين ، نتائج BLAST بتنسيق رسومي. يمثل الشريط العلوي تسلسل الاستعلام. توضح الأشرطة أدناه المنطقة (المناطق) في التسلسلات الأخرى المتطابقة مع تسلسل الاستعلام. يشير لون الشريط إلى حجم درجة بلاست. انقر فوق أحد هذه الأشرطة لرؤية محاذاة BLAST مقترنة بتسلسل الاستعلام.

        أعمدة البحث
        SSearch هو تنفيذ مزدوج لخوارزمية محاذاة Smith-Waterman. عند محاذاة تسلسلين ، يتم عرض المنطقة المشتركة فقط. داخل المنطقة المشتركة ، يمكن محاذاة بقايا الأحماض الأمينية من أحد التسلسل أو كليهما إما مع الأحماض الأمينية أو الفجوات من التسلسل الآخر. يتم تمثيل الطول الإجمالي للمنطقة المشتركة ، بما في ذلك الفجوات ، تحت عمود التداخل. يتم إعطاء النسبة المئوية للمخلفات المتطابقة في المحاذاة تحت٪ iden. يؤدي النقر فوق هذا الرقم إلى عرض محاذاة SSearch كاملة الطول.

        5- إظهار كافة الأعضاء
        من خلال النقر فوق هذا الشعار ، ستتمكن من رؤية جميع التسلسلات التي تنتمي إلى مجموعات فردية.

        تعليمات بحث FASTA

        ما هي فاستا؟
        يمكن استخدام FASTA للبحث في قواعد بيانات التسلسل وتقييم درجات التشابه وتحديد الهياكل الدورية بناءً على تشابه التسلسل المحلي. يمكن لبرنامج FASTA مقارنة تسلسل البروتين بقاعدة بيانات تسلسل الحمض النووي عن طريق ترجمة قاعدة بيانات الحمض النووي أثناء البحث عنها. يعرض محرك البحث هذا نتائج FASTA (حتى 200 تطابق) ، باستخدام برنامج FASTA (Pearson and Lipman ، 1988) مع الإعدادات الافتراضية.

        تنسيق بحث FASTA
        تقبل منطقة الإدخال FASTA "بحث":

        خيارات FASTA
        -يتوقع
        تحدد عتبة توقع (القيمة الإلكترونية) عتبة دلالة إحصائية للإبلاغ عن تطابق تسلسل قاعدة البيانات. القيمة الافتراضية هي 0.0001 ، مما يعني أنه من المتوقع العثور على 0.0001 مطابقات بالصدفة فقط. تعد حدود التوقعات المنخفضة أكثر صرامة ، مما يؤدي إلى تقليل حالات تطابق الفرص التي يتم الإبلاغ عنها. تُظهر زيادة الحد الأقصى المتوقع تطابقات أقل صرامة ويوصى به عند إجراء عمليات بحث بتسلسلات قصيرة حيث من المرجح أن يحدث الاستعلام القصير عن طريق الصدفة في قاعدة البيانات أكثر من الاستفسار الأطول ، لذلك حتى المطابقة الكاملة (بدون فجوات) يمكن أن يكون لها أهمية إحصائية منخفضة وقد لا يتم الإبلاغ عنها. تسمح لك زيادة عتبة توقع بالنظر إلى أسفل في قائمة النتائج ومشاهدة التطابقات التي عادةً ما يتم تجاهلها بسبب الأهمية الإحصائية المنخفضة.

          Pearson WR و DJ Lipman (1988) أدوات محسنة لمقارنة التسلسل البيولوجي. بروك. ناتل. أكاد. علوم. الولايات المتحدة الأمريكية 85 (8): 2444-2448.

        نتائج FASTA مساعدة

        يظهر أدناه نموذج لإخراج بحث بلاست مقابل قاعدة بيانات UniProtKB

        1- تشغيل تسلسل الاستعلام
        انقر فوق هذا الزر لعرض تسلسل الاستعلام. على العكس من ذلك ، انقر فوقه مرة أخرى لإخفائه.

        2- حفظ النتائج باسم
        يمكن حفظ نتائج البحث على جهاز الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        فرز الأعمدة
        يمكن فرز الأعمدة حسب القيم المقابلة من خلال النقر على السهم الموجود بجوار عنوان العمود. بشكل افتراضي ، يتم فرز الجدول حسب الدرجة.

        يتم عرض نتائج البحث في جدول يحتوي على الأعمدة الافتراضية التالية:

        AC / ID البروتين
        يشير معرف / معرف البروتين إلى رقم تعريف ومعرف UniProtKB على التوالي. أسفل هذه المعرفات ، يمكنك اختيار إما عرض iProClass أو عرض UniProtKB لتقرير البروتين. يظهر مصدر تسلسل UniProtKB كـ UniProtKB / Swiss-Prot أو UniProtKB / TrEMBL إذا كان تسلسل البروتين من قسم Swiss-Prot أو TrEMBL من UniProtKB ، على التوالي.

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        معرف PIRSF
        إذا كان البروتين ينتمي إلى عائلة PIRSF ، فسيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF (انظر الإخراج المشروح).

        أعمدة تشابه التسلسل
        هناك ثلاثة أعمدة مرتبطة بنتائج FASTA. يُظهر عمود المحاذاة ، في أقصى اليمين ، نتائج FASTA بتنسيق رسومي. يمثل الشريط العلوي تسلسل الاستعلام. توضح الأشرطة أدناه المنطقة (المناطق) في التسلسلات الأخرى المتطابقة مع تسلسل الاستعلام. يشير لون الشريط إلى حجم درجة FASTA. انقر فوق أحد هذه الأشرطة لرؤية محاذاة FASTA مقترنة بتسلسل الاستعلام.

        تعليمات التسلسل ذات الصلة

        استرجع التسلسلات ذات الصلة بناءً على نتائج BLAST المحسوبة مسبقًا ، وبالتالي ستتمكن من إلقاء نظرة على البروتينات المشابهة لاستعلامك ، أسرع بكثير من تشغيل BLAST. يتم تنفيذ هذا الإجراء كل ثلاثة أشهر تقريبًا. أدخل معرف تسلسل UniProtKB وانقر فوق الزر "بحث".

        1- عرض القيمة الإلكترونية
        حدد حد القيمة الإلكترونية لعرض نتائجك.

        2- تشغيل تسلسل الاستعلام
        انقر فوق هذا الزر لعرض تسلسل الاستعلام. على العكس من ذلك ، انقر فوقه مرة أخرى لإخفائه.

        3- حفظ النتائج باسم
        يمكن حفظ نتائج البحث على جهاز الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        فرز الأعمدة
        يمكن فرز الأعمدة حسب القيم المقابلة من خلال النقر على السهم الموجود بجوار عنوان العمود. بشكل افتراضي ، يتم فرز الجدول حسب الدرجة.

        يتم عرض نتائج البحث في جدول يحتوي على الأعمدة الافتراضية التالية:

        AC / ID البروتين
        يشير معرف / معرف البروتين إلى رقم تعريف ومعرف UniProtKB على التوالي. أسفل هذه المعرفات ، يمكنك اختيار إما عرض iProClass أو عرض UniProtKB لتقرير البروتين. يظهر مصدر تسلسل UniProtKB كـ UniProtKB / Swiss-Prot أو UniProtKB / TrEMBL إذا كان تسلسل البروتين من قسم Swiss-Prot أو TrEMBL من UniProtKB ، على التوالي.

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        معرف PIRSF
        إذا كان البروتين ينتمي إلى عائلة PIRSF ، فسيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF (انظر الإخراج المشروح).

        أعمدة تشابه التسلسل
        هناك ثلاثة أعمدة مرتبطة بنتائج بلاست. يُظهر عمود المحاذاة ، في أقصى اليمين ، نتائج BLAST بتنسيق رسومي. يمثل الشريط العلوي تسلسل الاستعلام. توضح الأشرطة أدناه المنطقة (المناطق) في التسلسلات الأخرى المتطابقة مع تسلسل الاستعلام. يشير لون الشريط إلى حجم درجة بلاست. انقر فوق أحد هذه الأشرطة لرؤية محاذاة مقترنة بتسلسل الاستعلام.

        مباراة الببتيد


        صفحة نتيجة مطابقة الببتيد

        1- الاستعلام عن الببتيد
        إظهار الببتيد الاستعلام والسماح للمستخدم بإجراء بحث جديد عن طريق إرسال ببتيد استعلام جديد.

        2- حفظ النتائج باسم
        يمكن حفظ الإخراج على الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        AC / ID البروتين
        يشير معرف البروتين / معرف البروتين إلى معرفات UniProtKB أو UniRef100. أسفل هذه الأرقام ، يمكنك اختيار إما iProClass أو عرض UniProtKB / UniRef100 لكل تقرير بروتين. يظهر مصدر تسلسل UniProtKB كـ UniProtKB / Swiss-Prot أو UniProtKB / TrEMBL إذا كان تسلسل البروتين من Swiss-Prot أو TrEMBL ، على التوالي.

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        معرف PIRSF
        إذا كان البروتين ينتمي إلى عائلة PIRSF ، فسيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF (انظر الإخراج المشروح).

        نطاق المباراة
        يعرض هذا العمود باللون الأحمر الاستعلام الببتيد داخل التسلسل.

        5- كائنات متعددة
        انقر لإظهار معرفات التصنيف للكائنات المتطابقة.

        6- تصفح حسب مجموعة التصنيف
        انقر لإظهار مجموعات التصنيف للتسلسلات المتطابقة كما هو موضح أدناه.

        البحث عن الأنماط

        النمط عبارة عن صيغة (تعبير عادي) تمثل المنطقة المحفوظة لمجموعة من البروتينات ذات الصلة. بمجرد إنشائه ، يتم استخدام النموذج بواسطة برنامج مطابقة الأنماط للعثور على التكرارات المحتملة للمنطقة المحفوظة في قاعدة بيانات التسلسل.

        PROSITE هي قاعدة بيانات تحتوي على أنماط وملفات تعريف خاصة بأكثر من ألف عائلة أو مجالات بروتينية. تأتي كل من هذه التواقيع مصحوبة بوثائق توفر معلومات أساسية عن بنية ووظيفة هذه البروتينات.

        يمكن أن يساعد تحديد الأنماط في البروتين أو مجموعة البروتينات في تقييم وظيفة البروتين أو التنبؤ بتعديل معين بعد الترجمة. ومع ذلك ، يجب إجراء مزيد من التحقيق في نتائج البحث عن الأنماط ، نظرًا لطبيعة النهج ، غالبًا ما تكون الأنماط محددة للغاية (العديد من السلبيات الخاطئة) أو انتقائية بشكل غير كاف (احتمال كبير لحدوثها). كما هو الحال ، على سبيل المثال ، لنمط PROSITE:
        PS00001
        معرف نمط ASN_GLYCOSYLATION.
        موقع DE N-glycosylation.
        مقلاة-

        -[شارع]-


        يمكن العثور على هذا النمط في معظم البروتينات ، ومع ذلك ، فإن الارتباط بالجليكوزيل هو تعديل يحدث في الشبكة الإندوبلازمية أثناء تخليق الغشاء والبروتينات المفرزة.

          استخدم الأحرف الكبيرة لمخلفات الأحماض الأمينية وضع علامة "-" بين نوعين من الأحماض الأمينية (غير مطلوب).

        • [LIVM] تعني أن L ، أو I ، أو V ، أو M يمكن أن تكون في الموضع الأول.
        • يعني أن C و F لا ينبغي أن يكونا في هذا الموضع المحدد
        • x (3) هو نفسه "xxx"
        • يمثل "x (1،4)" x "أو" xx "أو" xxx "أو" xxxx "
        • يبحث "& gtMDEL" عن التسلسلات التي تبدأ بـ MDEL فقط
        • يبحث "DEL & gt" فقط عن التسلسلات التي تنتهي بـ DEL

        ملاحظة: يمكنك أيضًا كتابة النمط أعلاه على النحو التالي:
        [LIVM] [VIC] x (2) G [DENQTA] x [GAC] x (2) [LIVMFY] (4) x (2) G

        نتيجة البروتينات بنمط PROSITE PS00888 (توقيع مجال ربط النوكليوتيدات الدوري 1)

        1- حفظ النتائج باسم
        يمكن حفظ الإخراج على الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        3- عرض النتائج
        يتم عرض نتائج البحث في جدول. يمكن فرز الأعمدة حسب القيم المقابلة من خلال النقر على السهم الموجود بجوار عنوان العمود.

        AC / ID البروتين
        يشير معرف / معرف البروتين إلى انضمام ومعرف UniProtKB ، على التوالي. أدناه ، يمكنك اختيار إما عرض iProClass أو عرض UniProtKB لكل تقرير بروتين. يظهر مصدر تسلسل UniProtKB كـ UniProtKB / Swiss-Prot أو UniProtKB / TrEMBL إذا كان تسلسل البروتين من Swiss-Prot أو TrEMBL ، على التوالي.

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        معرف PIRSF
        إذا كان البروتين ينتمي إلى عائلة PIRSF ، فسيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF (انظر الإخراج المشروح).

        نطاق المباراة
        يعرض هذا العمود نطاق التسلسل لنمط الاستعلام.

        نتيجة جزئية لأنماط PROSITE في UniProtKB O05689

        تعليمات المحاذاة المتعددة

        حدد برنامج المحاذاة: ClustalW أو T-Cofee أو Muscle. بعد ذلك ، أدخل تسلسلات متعددة (لا تزيد عن 70) مع سطور المعرف المقابلة لها بتنسيق FASTA ، أو أدخل معرفات UniProtKB متعددة مفصولة بأسطر أو فاصلات أو مسافات. ثم انقر على زر الإرسال.
        ستعرض صفحة النتائج عارض المحاذاة والمحاذاة. بالنسبة إلى ClustalW و T-Coffee ، يمكن عرض شجرة الانضمام المجاورة والمحاذاة وتحريرها وحفظها باستخدام عارض PIR-TAV أو JalView (انظر أدناه). للعضلات فقط جالفيو متاح.

        تنسيق FASTA
        يبدأ التسلسل بتنسيق FASTA بوصف من سطر واحد ، متبوعًا بسطر من بيانات التسلسل. يتم تمييز سطر الوصف عن بيانات التسلسل برمز أكبر من (">") في العمود الأول. تتمثل إحدى فوائد استخدام تنسيق FASTA في أنه سيتم الإبلاغ عن معرف التسلسل مع النتائج. مثال على تسلسل بتنسيق FASTA هو:

        > جي | 3287971 | س | P37025 | LIGT_ECOLI 2'-5 "RNA يغاز MSEPQRLFFAIDLPAEIREQIIHWRATHFPPEAGRPVAADNLHLTLAFLGEVSAEK EKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQLANMLRSQA ARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGRTRY TPLKRWALTQ

        تعليمات المحاذاة الزوجية

        أدخل تسلسلين باستخدام رمز الأحماض الأمينية الفردي أو أدخل اثنين من رموز معرفات UniProtKB. اضغط على الزر "إرسال" وستظهر نتائج المحاذاة محاذاة SSEARCH Smith-Waterman كاملة الطول بين تسلسلين (إصدار برنامج SSEARCH 3.4t24 21 يوليو 2004).

        المحاذاة الزوجية لـ P53039 و Q6FQ69

        تعليمات تعيين المعرف

        تسمح هذه الوظيفة بتعيين المعرفات بين UniProtKB وقواعد البيانات الأخرى

        حدد أولاً نوع معرف بيانات المصدر (يمكن تحديد أنواع متعددة من المعرفات باستخدام مفتاح ctrl). حدد نوع المعرف الذي تريد التعيين إليه. اكتب أو الصق المعرفات في المربع المقدم مفصولاً بمسافة أو مفتاح رجوع. بدلاً من ذلك ، يمكنك تحميل ملف بقائمة المعرفات. حدد تنسيق الإخراج وأخيراً اضغط على "خريطة".

        تحتوي صفحة النتائج على قائمة المطابقات المعرفية. يمكن قص المعرفات ولصقها إذا لزم الأمر أو حفظها كملف نصي باستخدام خيار "حفظ باسم" الذي يوفره متصفح الويب الخاص بك.
        انظر الإخراج المشروح أدناه.

        تعيين أرقام GI إلى UniProt ACs

        تكوين / حساب الوزن الجزيئي مساعدة

        استرجع معلومات التركيب والوزن الجزيئي لسلسلة مفردة أو متعددة بناءً على معرف UniProtKB أو رمز الأحماض الأمينية المفرد. تحتوي النتائج على عدد المخلفات والنسبة المئوية لكل حمض أميني في التسلسل. يتم أيضًا تقديم ملاحظات الحساب للوزن الجزيئي والوزن الجزيئي لكل حمض أميني.

        تكوين الوزن الجزيئي لـ P53039

        مسح PIRSF

        ابحث في تسلسل الاستعلام الخاص بك مقابل عائلات PIRSF المنسقة بالكامل. عند إرسال تسلسل الاستعلام الخاص بك ، سيتم البحث عنه مقابل نماذج HMM كاملة الطول والمجال لبرامج PIRSFs المنسقة بالكامل بواسطة برنامج HMMER. إذا تم العثور على تطابق ، سيتم عرض المناطق والإحصائيات المتطابقة. يجب إدخال تسلسل الاستعلام باستخدام رمز حرف واحد أو معرف UniProtKB.

        جدول كود تسلسل الأحماض الأمينية

        معرفات UniProtKB لأدوات البحث والتحليل BLAST / FASTA

        يوضح الجدول التالي أمثلة عن رقم ومعرف انضمام UniProtKB

        تقرير PIRSF تقرير عينة لـ PIRSF000186. يتم توفير معلومات حول الحقول المرقمة أدناه. 1- عرض PIRSF Hierarchy DAG 2- التوزيع التصنيفي لـ PIRSF 3- المحاذاة المتعددة 4- هندسة المجال

        تعليمات دليل البروتين الرئيسية

        يصف هذا القسم صفحة البحث عن نص دليل البروتين الرئيسي. يحتوي الدليل الرئيسي على معلومات عن البروتينات والكواشف التي تم تحديدها بواسطة مراكز أبحاث البروتينات الحيوية للدفاع الحيوي التابعة لـ NIAID. يتشابه التخطيط العام للصفحة مع نتائج البحث العادية عن نص PIR ، إلا أنه يختلف في الأعمدة الافتراضية المعروضة وله سمات إضافية للبحث. هناك نوعان من شاشات العرض العمودي 1) العرض الافتراضي الذي يتم استخدامه لعرض أنواع بيانات متعددة معًا (مثل MS_proteomic و Microarray) و ، 2) نوع البيانات المحدد الذي يتم استخدامه عند تحديد نوع بيانات واحد فقط ويحتوي على معلومات إضافية تنطبق على تلك البيانات اكتب فقط. لعرض عرض البيانات المحدد من القائمة المنسدلة - حدد نوع البيانات لعرضه - حدد نوع البيانات.

        العرض الافتراضي لأنواع البيانات المتعددة

        عرض خاص بنوع البيانات (ميكروأري)

        خيارات البحث والنتائج

        1- تصفح التحديد
        بشكل افتراضي ، يعرض الدليل جميع البيانات. تتيح لك هذه الميزة ، وهي قائمة منسدلة من الخيارات في الجزء العلوي من الصفحة ، تقييد التصفح الخاص بك عن طريق 1) نوع البيانات ، 2) مركز أبحاث البروتينات و 3) الكائن الحي

        2- بحث
        يسمح لك بإجراء بحث إضافي في حالة رغبتك في زيادة تصفية مخرجاتك أو إذا كنت تريد بدء بحث جديد (لا داعي للعودة إلى الصفحة السابقة). تظهر الخيارات المتاحة في قائمة منسدلة وهي نفس سمات البروتين الموجودة في قاعدة بيانات iProClass مع إضافة سمات خاصة بالدليل مدرجة ضمن العنوان "الدليل الرئيسي". أدخل أي سلسلة نصية أو سلسلة فرعية ، لا يهم حالة الأحرف. إذا كنت ترغب في تحديد وجود أو عدم وجود قيمة فقط ، فاستخدم الكلمتين "not null" أو "null". مسموح بأحرف البدل.

        3- خيارات العرض
        بناءً على حاجتك المحددة ، يمكنك اختيار الأعمدة المراد عرضها. للقيام بذلك ، انقر فوق الزر "خيار العرض" ، وحدد الحقل (الحقول) ذات الصلة في قائمة "الحقول غير المعروضة" وانقلها إلى قائمة "الحقول في العرض" عبر الزر ">". على العكس من ذلك ، يمكن إزالة الأعمدة من العرض. أخيرًا ، انقر فوق "تطبيق" لتصبح التغييرات سارية المفعول.

        4- حفظ النتائج باسم
        يمكن حفظ الإخراج على الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.


        عرض خاص بنوع البيانات (ميكروأري)

        6- عرض النتائج
        يتم عرض نتائج البحث في جدول قابل للتخصيص. ستعتمد الأعمدة الدقيقة المعروضة على الحقول التي يتم البحث عنها وتفضيلات المستخدم.

        AC / ID البروتين
        يشير معرف البروتين / معرف البروتين إلى معرفات UniProtKB أو UniParc. أسفل هذه الأرقام ، يمكنك اختيار إما عرض iProClass أو عرض UniProtKB / UniParc لتقرير البروتين. يظهر مصدر تسلسل UniProtKB كـ UniProtKB / Swiss-Prot أو UniProtKB / TrEMBL إذا كان تسلسل البروتين من قسم Swiss-Prot أو TrEMBL من UniProt Knowledgebase ، على التوالي. بدلاً من ذلك ، سيتم عرض معرف UniParc إذا لم يكن التسلسل موجودًا في قاعدة بيانات UniProtKB ولكنه موجود في UniParc.

        معرف
        معرف الدليل هو معرف فريد يتم اختياره من البيانات المقدمة من مركز الأبحاث البروتينية. يتم استخدامه في الدليل الرئيسي لتحديد نتيجة بحث معينة وربط معلومات البروتين في الدليل الرئيسي بالنتائج التفصيلية في بنك البروتين.

        مركز
        يحدد مركز أبحاث NIAID Biodefense Proteomics الذي أنتج البيانات. يؤدي النقر فوق الاسم إلى إظهار معلومات إضافية عن المركز والبيانات التي قدموها.

        نوع البيانات
        يحدد نوع البيانات المقدمة. يؤدي النقر فوق اسم نوع البيانات إلى فتح نافذة جديدة تحتوي على معلومات البروتين الموضحة في التنسيق المحدد لنوع البيانات.

        تجربة #
        روابط للبيانات التجريبية ذات الصلة في بنك بيانات البروتين.

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        معرف PIRSF
        إذا كان البروتين ينتمي إلى عائلة PIRSF ، فسيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF (انظر الإخراج المشروح).

        7 خيارات البحث الخاصة بنوع البيانات
        يمكن البحث في جميع الحقول المشتركة المذكورة أعلاه كما يمكن البحث في أي أعمدة اختيارية قد يضيفها المستخدم. بالإضافة إلى ذلك ، هناك حقول خاصة بنوع البيانات يتم عرضها فقط في شاشة العرض الخاصة بنوع البيانات ولكن يمكن البحث عنها أيضًا. ملاحظة: قد تكون بعض الحقول الخاصة بالكواشف فارغة.

        أكمل مساعدة البروتينات المتنبأ بها

        تسمح هذه الأداة بإجراء عمليات البحث عن النص التي تقتصر على البروتينات الكاملة كما تم شرحها بواسطة UniProt Consortium والتي يتم دراستها بواسطة برنامج Biodefense Proteomics Research. ترتبط النتائج بدليل البروتين الرئيسي الذي يحتوي على معلومات تجريبية حول بعض البروتينات.

        للبدء ، حدد البروتينات التي تهمك وابحث.

        خيارات البحث والنتائج

        1- بحث
        بمجرد دخولك إلى الأداة ، يمكنك تقييد البحث بشكل أكبر. تظهر الخيارات المتاحة في قائمة منسدلة وهي نفس سمات البروتين الموجودة في قاعدة بيانات iProClass مع إضافة خيار - Master Directory (MD). أدخل أي سلسلة نصية أو سلسلة فرعية ، لا يهم حالة الأحرف.إذا كنت ترغب في تحديد وجود (+) أو غياب (فارغ) لقيمة ما ، فاستخدم الكلمتين "ليس فارغًا" أو "خالٍ". يسمح بالبحث عن أحرف البدل.

        2- خيارات العرض
        بناءً على حاجتك المحددة ، يمكنك اختيار الأعمدة المراد عرضها. للقيام بذلك ، انقر فوق الزر "خيار العرض" ، وحدد الحقل (الحقول) ذات الصلة في قائمة "الحقول غير المعروضة" وانقلها إلى قائمة "الحقول في العرض" عبر الزر ">". على العكس من ذلك ، يمكن إزالة الأعمدة من العرض. أخيرًا ، انقر فوق "تطبيق" لتصبح التغييرات سارية المفعول.

        3- حفظ النتائج باسم
        يمكن حفظ الإخراج على الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد بروتينات ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل. سيؤدي النقر فوق "FASTA" إلى حفظ المعرفات والتسلسلات بتنسيق FASTA.

        5- عرض النتائج
        يتم عرض نتائج البحث في جدول قابل للتخصيص. ستعتمد الأعمدة الدقيقة المعروضة على الحقول التي يتم البحث عنها وتفضيلات المستخدم.

        AC / ID البروتين
        يشير معرف البروتين / معرف البروتين إلى معرفات UniProtKB أو UniParc. أسفل هذه الأرقام ، يمكنك اختيار إما عرض iProClass أو عرض UniProtKB / UniParc لتقرير البروتين. يظهر مصدر تسلسل UniProtKB كـ UniProtKB / Swiss-Prot أو UniProtKB / TrEMBL إذا كان تسلسل البروتين من قسم Swiss-Prot أو TrEMBL ، على التوالي. بدلاً من ذلك ، سيتم عرض معرف UniParc إذا لم يكن التسلسل موجودًا في قاعدة بيانات UniProtKB جنبًا إلى جنب مع تقرير UniParc.

        MD (الدليل الرئيسي)
        يشار إلى أي بروتين يحتوي على معلومات موجودة في الدليل الرئيسي لبرنامج Biodefense Proteomics Research بعلامة (+) في عمود MD. لتقييد بحثك على البروتينات الموجودة في MD فقط ، حدد "الدليل الرئيسي" في خيارات حقل البحث وأدخل القيمة "نعم" أو "ليس فارغًا".

        اسم البروتين
        الاسم الشائع الذي يطلق على البروتين ، والذي يحدد وظيفته أو يحدد خصائصه.

        طول
        عدد بقايا الأحماض الأمينية في الببتيد أو البروتين.

        اسم الكائن الحي
        جنس وأنواع كائن المصدر الذي نشأ منه التسلسل. يتم توفير روابط لمعلومات تصنيف NCBI.

        معرف PIRSF
        إذا كان البروتين ينتمي إلى عائلة PIRSF ، فسيعرض هذا العمود معرف العائلة المقابل. انقر فوق المعرف لاسترداد تقرير PIRSF (انظر الإخراج المشروح).

        التسلسل ذات الصلة.
        يوضح هذا العمود عدد مرات الوصول إلى BLAST المحسوبة مسبقًا والتي تم الحصول عليها باستخدام المعلمات الافتراضية. سيتم عرض ما يصل إلى 300 تسلسل فقط. بالنقر على الرقم يمكنك الوصول إلى صفحة التسلسل ذات الصلة. يتيح ذلك إلقاء نظرة سريعة على تشابه التسلسل بطريقة سريعة جدًا. يوفر الرقم نفسه بالفعل بعض المعلومات حول مدى تميز البروتين. على سبيل المثال ، قد يخبرك رقم منخفض جدًا أن الاستعلام خاص بنوع معين ، أو جنس ، أو أصنف ، وما إلى ذلك. تسمح علامة "+" بجوار عنوان التسلسل المرتبط بمقارنة عدد التسلسلات ذات الصلة بثلاثة قيم E مختلفة القطع كما هو مبين أدناه.

        تحليل GO Slim

        GO Slims هي إصدارات أصغر من Gene Ontology تحتوي على مجموعة فرعية من المصطلحات في GO بأكملها. يقدمون نظرة عامة واسعة على محتوى الأنطولوجيا بدون تفاصيل المصطلحات الدقيقة المحددة. تعتبر GO Slims مفيدة بشكل خاص لإعطاء ملخص لنتائج شرح GO للجينوم أو البروتين عندما يكون التصنيف الواسع لوظيفة المنتج الجيني مطلوبًا.

        يمكنك عرض مصطلحات GO Slim للوظيفة البيولوجية والمكون والعملية عن طريق تحديد الزر "إظهار GO Slim" في شريط أدوات التحليل. يمكنك بعد ذلك عرض إحصائيات الأنطولوجيا الفردية (الوظيفة والمكون والوظيفة) عن طريق التحقق من إدخالات الاهتمام واختيار الأنطولوجيا التي تريد عرضها. اتبع روابط GO ID لمعرفة المزيد عن مصطلح GO.

        تعليمات دليل الكاشف الرئيسي

        يصف هذا القسم صفحة البحث عن نص دليل Master Reagent. يحتوي دليل الكاشف على الكواشف التي حددتها مراكز أبحاث البروتينات الحيوية للدفاع الحيوي التابعة لـ NIAID ويوفر روابط إلى المستودعات التي يمكن الحصول على الكواشف. يتشابه التخطيط العام للصفحة مع نتائج البحث العادية عن نص PIR ، إلا أنه يختلف في الأعمدة الافتراضية المعروضة وله سمات إضافية للبحث. عرضان عموديان 1) العرض الافتراضي الذي يستخدم لعرض أنواع متعددة من الكواشف معًا (أي الأجسام المضادة والمستنسخات) ، و 2) نوع الكاشف المحدد الذي يتم استخدامه عند تحديد نوع كاشف واحد فقط ويحتوي على معلومات إضافية تنطبق على هذا الكاشف فقط.

        العرض الافتراضي لأنواع الكواشف المتعددة

        عرض خاص بنوع الكاشف (الجسم المضاد)

        خيارات البحث والنتائج

        1- تصفح التحديد
        بشكل افتراضي ، يظهر الدليل جميع الكواشف. تتيح لك هذه الميزة ، وهي قائمة منسدلة من الخيارات ، تقييد التصفح الخاص بك عن طريق 1) نوع الكاشف ، 2) مركز أبحاث البروتينات و 3) الكائن الحي

        2- بحث
        يسمح لك بإجراء بحث إضافي في حالة رغبتك في زيادة تصفية مخرجاتك أو إذا كنت تريد بدء بحث جديد (لا داعي للعودة إلى الصفحة السابقة). تظهر الخيارات المتاحة في قائمة منسدلة (انظر الخيارات الحالية أدناه). أدخل أي سلسلة نصية أو سلسلة فرعية ، لا يهم حالة الأحرف. إذا كنت ترغب في تحديد وجود أو عدم وجود قيمة فقط ، فاستخدم الكلمتين "not null" أو "null".

        3- خيارات العرض
        بناءً على حاجتك المحددة ، يمكنك اختيار الأعمدة المراد عرضها. للقيام بذلك ، انقر فوق الزر "خيار العرض" ، وحدد الحقل (الحقول) ذات الصلة في قائمة "الحقول غير المعروضة" وانقلها إلى قائمة "الحقول في العرض" عبر الزر ">". على العكس من ذلك ، يمكن إزالة الأعمدة من العرض. أخيرًا ، انقر فوق "تطبيق" لتصبح التغييرات سارية المفعول.

        4- حفظ النتائج باسم
        يمكن حفظ الإخراج على الكمبيوتر المحلي للمستخدم. سيتم حفظ النتائج للإدخالات المحددة أو ، إذا لم يتم تحديد أي كواشف ، لجميع الإدخالات. سيؤدي النقر فوق "جدول" إلى حفظ الأعمدة المعروضة كملف نصي محدد بعلامات جدولة ، والذي يمكن استيراده في جدول بيانات لتسهيل العرض أو التحليل.

        5- عرض النتائج
        يتم عرض نتائج البحث في جدول قابل للتخصيص. ستعتمد الأعمدة الدقيقة المعروضة على الحقول التي يتم البحث عنها وتفضيلات المستخدم. الأعمدة الافتراضية موضحة أدناه.

        معرف الكاشف
        يشير معرف الكاشف إلى معرف فريد. إذا تم إيداع الكاشف في مورد BEI ، فسيكون هو نفس المعرف المستخدم في BEI.

        نوع الكاشف
        يحدد نوع الكاشف. يؤدي النقر فوق اسم نوع الكاشف إلى فتح نافذة جديدة تحتوي على معلومات الكاشف الموضحة بتنسيق محدد الكاشف.

        الاسم / الوصف
        نص وصفي حول الكاشف.

        اسم الكائن الحي
        اسم جنس ونوع الكائن المصدر الذي تم تطوير الكاشف منه أو من أجله. على سبيل المثال: تُدرج السلالات البكتيرية هنا اسم الأنواع البكتيرية ، وليس السلالة. على الرغم من أن الأجسام المضادة تنشأ من الفئران أو الأرانب ، فإنها تسرد كائن المستضدات. يتم توفير روابط لمعلومات تصنيف NCBI.

        مركز
        يحدد مركز أبحاث NIAID Biodefense Proteomics الذي أنتج الكاشف. يؤدي النقر فوق الاسم إلى إظهار معلومات إضافية عن المركز والبيانات التي قدموها.

        تجربة #
        روابط للبيانات التجريبية ذات الصلة في بنك بيانات البروتين. إذا تم استخدام هذه الكواشف لمجموعة معينة من التجارب ، فإن هذا الرقم سيرتبط بتلك البيانات.

        النشر
        روابط لمنشورات جمهورية الصين الشعبية التي استخدمت الكاشف.

        مصدر
        روابط لمستودعات الكاشف حيث يمكن للمستخدمين الحصول على الكاشف.

        6- خيارات البحث الخاصة بالكاشف
        يمكن البحث في جميع الحقول المشتركة المذكورة أعلاه. بالإضافة إلى ذلك ، هناك حقول خاصة بالكاشف يتم عرضها فقط في شاشة العرض الخاصة بالكاشف ولكن يمكن البحث عنها أيضًا. ملاحظة: قد تكون بعض الحقول الخاصة بالكواشف فارغة.

        مساعدة البروتينات المرجعية

        1. ما هي البروتينات المرجعية؟
        البروتينات المرجعية (RPs) ، هي بروتينات يتم اختيارها من مجموعات البروتينات التمثيلية (RPGs) التي تحتوي على بروتينات مماثلة محسوبة على أساس العضوية المشتركة في مجموعات UniRef50. البروتين المرجعي هو البروتين الذي يمكن أن يمثل أفضل تمثيل لجميع البروتينات في مجموعته من حيث غالبية مساحة التسلسل والمعلومات. يتم توفير عتبة العضوية المشتركة بنسبة 75٪ و 55٪ و 35٪ و 15٪ للسماح للمستخدمين بتقليل أو زيادة دقة مساحة التسلسل بناءً على متطلباتهم.

        2. البحث عن البروتينات المرجعية BLAST.
        1. حدد قاعدة بيانات يمكن إجراء بحث BLAST مقابل RP75 أو RP55 أو RP35 أو RP15: تحتوي RPs المنخفضة (مثل RP15) على بروتينات أقل من RPs الأعلى (مثل RP75). على سبيل المثال ، للحصول على أقل عدد من نتائج بلاست ، اختر RP15. للحصول على مساعدة إضافية حول بلاست ، يرجى الاطلاع على https://proteininformationresource.org/pirwww/support/help.shtml#3.

        3. توافر واستخدام RP.
        بالنسبة لقيم العتبة 75 و 55 و 35 و 15 (RP75 و RP55 و RP35 و RP15) ، يتم توفير ملفات مجموعة Proteome التمثيلية المقابلة ، عبر روابط من صفحة RP الرئيسية ، بالتنسيق على النحو التالي: ملفات بتنسيق FASTA لمجموعات RP75 و RP55 و RP35 و RP15. يمكن للمستخدمين اختيار إنشاء مجموعة RP المخصصة الخاصة بهم باستخدام الجدول المستند إلى التصنيف أو البرنامج النصي perl المتاح عبر ارتباط من الصفحة الرئيسية لـ RP. على سبيل المثال ، نشك في أنه بالنسبة لبعض المستخدمين ، يمكن أن تكون المجموعة المثالية هي RP75 للحيوانات + RP55 للكائنات الخلوية الأخرى + أي جينومات GO مرجعية مفقودة.

        4. توفر البروتين المرجعي من واجهة iProClass.
        iProClass هو مستودع بيانات متكامل يحتوي على جميع بروتينات UniProtKB والبروتينات الإضافية من موارد NCBI. تتم فهرسة البروتينات من مجموعات البروتين التمثيلية المحددة في iProClass وهي متاحة لـ BLAST (http://proteininformationresource.org/rps/blast_rp.shtml). بالإضافة إلى ذلك ، يمكن استرداد جميع البروتينات من مجموعة RP55 من http://proteininformationresource.org/pirwww/search/textsearch.shtml عن طريق تحديد Rep Proteome ثم كتابة كلمة not null والنقر على بحث. يمكن للمستخدمين إجراء تصفية إضافية على المجموعة المستردة عن طريق إجراء عمليات بحث منطقية باستخدام أكثر من 65 حقلاً متاحة من القائمة المنسدلة للبحث عن النص. يمكن تنزيل نتائج البحث عن النص و BLAST من صفحة النتائج لمزيد من التحليل.

        5. تصفح البروتينات المرجعية.
        يمكن الاطلاع على RPs عند العتبات الأربعة المختلفة على http://proteininformationresource.org/cgi-bin/rps_tree.pl. أهم العقد هي Archaea و Bacteria و Eukaryota ويظهر العرض الموسع بالكامل جميع البروتينات التي تم تحليلها لتحديد RPs. يمكن أن يوفر استعراض RPs على عتبة مختلفة لعقد تصنيف مختلفة أدلة حول أفضل CMT لفرع معين وكيفية توزيع RPs في شجرة التصنيف. بمجرد عرض المجموعة المرغوبة من RPs على الشاشة ، يمكن طباعتها للرجوع إليها في المستقبل.

        6. تحديث بيانات البروتينات المرجعية.
        يتم تحديث مجموعات البروتين المستخدمة في البحث عن النص وبحث BLAST كل أربعة أسابيع. يتم إضافة بروتينات جديدة كل ستة أشهر. يتم أرشفة جميع الإصدارات لمدة 5 سنوات على الأقل.


        معلومات الكاتب

        الانتماءات

        قسم العلوم البيولوجية ، مختبر شمال غرب المحيط الهادئ الوطني ، ريتشلاند ، واشنطن ، 99352 ، الولايات المتحدة الأمريكية

        تشارلز أنسونغ ، صامويل إتش باين ، جيسيكا إل مارتن ، ميغان سي بورنت ، ماثيو إي مونرو ، ريتشارد دي سميث وجوشوا إن أدكنز

        مختبر العلوم الجزيئية البيئية ، مختبر شمال غرب المحيط الهادئ الوطني ، ريتشلاند ، واشنطن ، 99352 ، الولايات المتحدة الأمريكية

        نيكولا توليتش ​​وأمبير صامويل أو بورفين

        معهد أبحاث اللقاحات في سان دييغو ، سان دييغو ، كاليفورنيا ، 92121 ، الولايات المتحدة الأمريكية

        ستيفن بوروليك وأمبير مايكل ماكليلاند

        مركز موارد الجينوميات الوظيفية الممرضة ، معهد جيه كريج فينتر ، روكفيل ، دكتوراه في الطب ، 20850 ، الولايات المتحدة الأمريكية

        ماركوس جونز ، براتاب فينبالي وأمبير سكوت إن بيترسون

        قسم الأحياء الدقيقة الجزيئية والمناعة ، جامعة أوريغون للصحة والعلوم ، بورتلاند ، أوريغون ، 97239 ، الولايات المتحدة الأمريكية


        شاهد الفيديو: الدرس 24: مراحل الترجمة مراحل حدوث الترجمة1 (ديسمبر 2022).